• Gene id: 3912

Gene Summary

• Gene Symbol: LAMB1   Gene   UCSC   Ensembl
• Aliases: CLM, LIS5
• Gene name: laminin subunit beta 1
• Alternate names: laminin subunit beta-1, laminin B1 chain, laminin, beta 1,
• Gene location: 7q31.1 (108003175: 107923798)     Exons: 35     NC_000007.14
• Gene summary(Entrez): Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, n
• OMIM: 608116

Protein Summary

• Protein general information: P07942  
  • Name: Laminin subunit beta 1 (Laminin B1 chain) (Laminin 1 subunit beta) (Laminin 10 subunit beta) (Laminin 12 subunit beta) (Laminin 2 subunit beta) (Laminin 6 subunit beta) (Laminin 8 subunit beta)
  • Length: 1786  
  • Mass: 198038
• Sequence:

  MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKK
  CFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLI
  ERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFKIEDPYSPRIQ
  NLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMC
  RHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAVYLATGNVSGGVCDDCQHNTMGRNCE
  QCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTGLIAGQCRCKLNVEGEHCDVCKEGFYDLSSE
  DPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAE
  SGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAEEANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFF
  IDNIPYSMEYDILIRYEPQLPDHWEKAVITVQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKG
  TNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTP
  MTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHL
  QGSVNAFCNPVTGQCHCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLA
  GYYGDPIIGSGDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQP
  CQCHNNIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKA
  TGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDP
  DVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIIAELTNRTHRF
  LEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTT
  SQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSA
  LMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGERKC
  GGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNATKEKMDKSNEEL
  RNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAADIARAEMLL
  EEAKRASKSATDVKVTADMVKEALEEAEKAQVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISE
  LERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNE
  AKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL

• Structural information:
  • Protein Domains: (31..27-)
    (/note="Laminin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00466-)
    (271..33-)
    1 (/note="Laminin-EGF-like)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00460-)
    (335..39-)
    2 (/note="Laminin-EGF-like)
    (/evidence="ECO:-)
  • Interpro: IPR000742  IPR002049  IPR013015  IPR008211  IPR038684  
  • Prosite: PS00022 PS01186 PS01248 PS50027 PS51116 PS51117
  • PDB: 5XAU
  • PDBsum: 5XAU
  • STRING: ENSP00000222399
• Other Databases: GeneCards:  LAMB1  Malacards:  LAMB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005201	extracellular matrix structural constituent	IDA	molecular function
GO:0007155	cell adhesion	TAS	biological process
GO:0005606	laminin-1 complex	TAS	cellular component
GO:0050679	positive regulation of epithelial cell proliferation	TAS	biological process
GO:0005201	extracellular matrix structural constituent	IBA	molecular function
GO:0009887	animal organ morphogenesis	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0043256	laminin complex	IBA	cellular component
GO:0070831	basement membrane assembly	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0009888	tissue development	IBA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0021812	neuronal-glial interaction involved in cerebral cortex radial glia guided migration	IMP	biological process
GO:0005604	basement membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005198	structural molecule activity	NAS	molecular function
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	ISS	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0034446	substrate adhesion-dependent cell spreading	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0043257	laminin-8 complex	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0042476	odontogenesis	IDA	biological process
GO:0031175	neuron projection development	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005607	laminin-2 complex	IDA	cellular component
GO:0005606	laminin-1 complex	IDA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0043259	laminin-10 complex	IDA	cellular component
GO:0043259	laminin-10 complex	IDA	cellular component
GO:0035987	endodermal cell differentiation	IEP	biological process
GO:0005607	laminin-2 complex	TAS	cellular component
GO:0005606	laminin-1 complex	IPI	cellular component
GO:0005604	basement membrane	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0043257	laminin-8 complex	TAS	cellular component
GO:0005198	structural molecule activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa04512	ECM-receptor interaction
hsa05145	Toxoplasmosis
hsa05222	Small cell lung cancer
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Implantation failure	INFBASE: 1378028
Female infertility	INFBASE: 1378028
Endometriosis	INFBASE: 9022601
Teratozoospermia	MIK: 8270377
Oligoasthenozoospermia	MIK: 17187158
Azoospermia	MIK: 17804866
Teratozoospermia	MIK: 8270377
Male factor infertility	MIK: 17804866
Sertoli cell only syndrome (SCOS)	MIK: 17804866
Maturation arrest	MIK: 17804866
Non obstructive azoospermia	MIK: 17187158
Azoospermia	MIK: 17804866
Congenital bilateral absence of the vas deferens (CBAVD)	MIK: 17187158
Lissencephaly	KEGG:H00268
Lissencephaly	KEGG:H00268
autistic disorder	PMID:15523497
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray