• Gene id: 390664

Gene Summary

• Gene Symbol: C1QTNF8   Gene   UCSC   Ensembl
• Aliases: CTRP8, UNQ5829
• Gene name: C1q and TNF related 8
• Alternate names: complement C1q tumor necrosis factor-related protein 8, C1q and tumor necrosis factor related protein 8, C1q/TNF-related protein 8,
• Gene location: 16p13.3 (1096305: 1088225)     Exons: 5     NC_000016.10

Protein Summary

• Protein general information: P60827  
  • Name: Complement C1q tumor necrosis factor related protein 8 (C1q/TNF related protein 8) (CTRP8)
  • Length: 252  
  • Mass: 27685
  • Tissue specificity: Expressed predominantly in lung and testis (PubMed
• Sequence:

  MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVRPTIDIEILKGEKGEA
  GVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFD
  LAAGRFLCTVPGVYFLSLNVHTWNYKETYLHIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRD
  RDNAIYGEHGDLYITFSGHLVKPAAEL

• Structural information:
  • Protein Domains: (69..11-)
    (/note="Collagen-like-)
    (112..25-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • STRING: ENSP00000330426
• Other Databases: GeneCards:  C1QTNF8  Malacards:  C1QTNF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000147	positive regulation of cell motility	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq