• Gene id: 3906

Gene Summary

• Gene Symbol: LALBA   Gene   UCSC   Ensembl
• Aliases: LYZG
• Gene name: lactalbumin alpha
• Alternate names: alpha-lactalbumin, lactose synthase B protein, lysozyme G, lysozyme-like protein 7,
• Gene location: 12q13.11 (48571882: 48567683)     Exons: 5     NC_000012.12
• Gene summary(Entrez): This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these prote

Protein Summary

• Protein general information: P00709  
  • Name: Alpha lactalbumin (Lactose synthase B protein) (Lysozyme like protein 7)
  • Length: 142  
  • Mass: 16225
  • Tissue specificity: Mammary gland specific. Secreted in milk.
• Sequence:

  MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQIS
  NKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

• Structural information:
  • Protein Domains: (20..14-)
    (/note="C-type-lysozyme)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00680"-)
  • Interpro: IPR001916  IPR019799  IPR000545  IPR023346  
  • Prosite: PS00128 PS51348
  • PDB: 1A4V 1B9O 1CB3 1HML 3B0I 3B0O 4L41
  • PDBsum: 1A4V 1B9O 1CB3 1HML 3B0I 3B0O 4L41
  • STRING: ENSP00000301046
• Other Databases: GeneCards:  LALBA  Malacards:  LALBA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050830	defense response to Gram-positive bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0004461	lactose synthase activity	IEA	molecular function
GO:0005989	lactose biosynthetic process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005989	lactose biosynthetic process	IEA	biological process
GO:0005989	lactose biosynthetic process	TAS	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005989	lactose biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00052	Galactose metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881