• Gene id: 3904

Gene Summary

• Gene Symbol: LAIR2   Gene   UCSC   Ensembl
• Aliases: CD306
• Gene name: leukocyte associated immunoglobulin like receptor 2
• Alternate names: leukocyte-associated immunoglobulin-like receptor 2, LAIR-2, leukocyte-associated Ig-like receptor-2,
• Gene location: 19q13.42 (54502809: 54510692)     Exons: 5     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the immunoglobulin superfamily. It was identified by its similarity to leukocyte-associated immunoglobulin-like receptor 1, a membrane-bound receptor that modulates innate immune response. The protein encode
• OMIM: 617612

Protein Summary

• Protein general information: Q6ISS4  
  • Name: Leukocyte associated immunoglobulin like receptor 2 (LAIR 2) (CD antigen CD306)
  • Length: 152  
  • Mass: 16280
• Sequence:

  MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDSYNVF
  RLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGTVPGTEASGFD
  AP

• Structural information:
  • Protein Domains: (29..11-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • STRING: ENSP00000301202
• Other Databases: GeneCards:  LAIR2  Malacards:  LAIR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881