• Gene id: 3903

Gene Summary

• Gene Symbol: LAIR1   Gene   UCSC   Ensembl
• Aliases: CD305, LAIR-1
• Gene name: leukocyte associated immunoglobulin like receptor 1
• Alternate names: leukocyte-associated immunoglobulin-like receptor 1, immunoglobulin heavy chain variable region, leukocyte-associated Ig-like receptor 1,
• Gene location: 19q13.42 (54370555: 54351383)     Exons: 12     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including natural killer cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gen
• OMIM: 616178

Protein Summary

• Protein general information: Q6GTX8  
  • Name: Leukocyte associated immunoglobulin like receptor 1 (LAIR 1) (hLAIR1) (CD antigen CD305)
  • Length: 287  
  • Mass: 31412
  • Tissue specificity: Expressed on the majority of peripheral mononuclear cells, including natural killer (NK) cells, T-cells, B-cells, monocytes, and dendritic cells. Highly expressed in naive T-cells and B-cells but no expression on germinal center B-cell
• Sequence:

  MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVS
  QASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPTQRPSDNSHN
  EHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKAT
  VNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH

• Structural information:
  • Protein Domains: (29..11-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • PDB: 3KGR 3RP1
  • PDBsum: 3KGR 3RP1
  • STRING: ENSP00000375622
• Other Databases: GeneCards:  LAIR1  Malacards:  LAIR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881