• Gene id: 390113

Gene Summary

• Gene Symbol: OR4X1   Gene   UCSC   Ensembl
• Aliases: OR11-104
• Gene name: olfactory receptor family 4 subfamily X member 1
• Alternate names: olfactory receptor 4X1, olfactory receptor OR11-104,
• Gene location: 11p11.2 (48263860: 48264777)     Exons: 1     NC_000011.10
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Protein Summary

• Protein general information: Q8NH49  
  • Name: Olfactory receptor 4X1 (Olfactory receptor OR11 104)
  • Length: 305  
  • Mass: 34222
• Sequence:

  MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFFLSYLSFVEICYCSVM
  APKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDRYVAICKPLHYMAIMNQRMCGLLVRIAWGGG
  LLHSVGQTFLIFQLPFCGPNIMDHYFCDVHPVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRS
  HNLEGQHKALSTCASHVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFI
  GGKVI

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000321506
• Other Databases: GeneCards:  OR4X1  Malacards:  OR4X1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)