Search Result
Gene id | 389903 | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||
Gene Summary |
|||||||||||||||||
Gene Symbol | CSAG3 Gene UCSC Ensembl | ||||||||||||||||
Aliases | CSAG3A, CT24.2 | ||||||||||||||||
Gene name | CSAG family member 3 | ||||||||||||||||
Alternate names | chondrosarcoma-associated gene 2/3 protein, CSAG family, member 3A, cancer/testis antigen 24.2, taxol resistance associated gene 3, taxol-resistant-associated gene 3 protein, | ||||||||||||||||
Gene location |
Xq28 (152753920: 152760221) Exons: 5 NC_000023.11 |
||||||||||||||||
OMIM | 602728 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
Protein general information | Q9Y5P2 Name: Chondrosarcoma associated gene 2/3 protein (Cancer/testis antigen 24.2) (CT24.2) (Taxol resistant associated gene 3 protein) (TRAG 3) Length: 127 Mass: 14430 Tissue specificity: Weakly expressed in kidney. Expressed in various tumor cell lines including carcinomas, myeloid and lymphoid malignancies, melanomas and prostate cancer. Overexpressed in taxol-resistant breast cancer line MDA 435TR and the doxorubicin | ||||||||||||||||
Sequence |
MWMGLIQLVEGVKRKDQGFLEKEFYHKTNIKMRCEFLACWPAFTVLGEAWRDQVDWSRLLRDAGLVKMSRKPRAS SPLSNNHPPTPKRRGSGRHPLNPGPEALSKFPRQPGREKGPIKEVPGTKGSP | ||||||||||||||||
Structural information | |||||||||||||||||
Other Databases | GeneCards: CSAG3  Malacards: CSAG3 | ||||||||||||||||
Gene ontology
|
|||||||||||||||||
| |||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||
| |||||||||||||||||
PubMed references
|
|||||||||||||||||
|