• Gene id: 389898

Gene Summary

• Gene Symbol: UBE2NL   Gene   UCSC   Ensembl
• Aliases: Li174
• Gene name: ubiquitin conjugating enzyme E2 N like (gene/pseudogene)
• Alternate names: putative ubiquitin-conjugating enzyme E2 N-like, epididymis tissue protein Li 174, ubiquitin conjugating enzyme E2N-like,
• Gene location: Xq27.3 (57988253: 57971546)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene is intronless and encodes a member of the ubiquitin-conjugating enzyme family. The protein product is 91% identical to ubiquitin-conjugating enzyme E2N, a multi-exon gene product. This locus represents a polymorphic pseudogene, where some indivi

Protein Summary

• Protein general information: Q5JXB2  
  • Name: Putative ubiquitin conjugating enzyme E2 N like (Epididymis tissue protein Li 174)
  • Length: 153  
  • Mass: 17377
  • Tissue specificity: Expressed in epididymis (at protein level). {ECO
• Sequence:

  MAELPHRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGESKDSPFEGGTFKRELLLAEEYPMAAPKVRFMTK
  IYHPNVDKLERISLDILKDKWSPALQIRTVLLSIQALLNAPNPDDPLANDVVEQWKTNEAQAIETARAWTRLYAM
  NSI

• Structural information:
  • Interpro: IPR000608  IPR016135  
  • Prosite: PS50127
  • CDD: cd00195
• Other Databases: GeneCards:  UBE2NL  Malacards:  UBE2NL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006301	postreplication repair	IBA	NOT|biological process
GO:0061631	ubiquitin conjugating enzyme activity	IBA	molecular function
GO:0070534	protein K63-linked ubiquitination	IBA	NOT|biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04120	Ubiquitin mediated proteolysis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)