• Gene id: 389874

Gene Summary

• Gene Symbol: ZCCHC13   Gene   UCSC   Ensembl
• Aliases: CNBP2, ZNF9L
• Gene name: zinc finger CCHC-type containing 13
• Alternate names: zinc finger CCHC domain-containing protein 13, zinc finger, CCHC domain containing 13,
• Gene location: Xq13.2 (74304179: 74305033)     Exons: 1     NC_000023.11
• Gene summary(Entrez): This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 3. However, the CDS of this intronless gene remains relatively intact, it is conserved in other mammalian species, it is known to be transcribed, and

Protein Summary

• Protein general information: Q8WW36  
  • Name: Zinc finger CCHC domain containing protein 13
  • Length: 166  
  • Mass: 18005
• Sequence:

  MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGH
  IAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQ
  LLPLRQIPTSSQGMSQ

• Structural information:
  • Interpro: IPR001878  IPR036875  
  • Prosite: PS50158
  • STRING: ENSP00000345633
• Other Databases: GeneCards:  ZCCHC13  Malacards:  ZCCHC13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:2000767	positive regulation of cytoplasmic translation	IBA	biological process
GO:0003727	single-stranded RNA binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0045182	translation regulator activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non-obstructive azoospermia	MIK: 29531833

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29531833	Non-obstructive azoospermia			4 with Non Obstructive Azoospermia	Male infertility	NGS
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881