• Gene id: 389827

Gene Summary

• Gene Symbol: MYMK   Gene   UCSC   Ensembl
• Aliases: MYOMAKER, TMEM226, TMEM8C
• Gene name: myomaker, myoblast fusion factor
• Alternate names: protein myomaker, myoblast fusion maker, transmembrane protein 226, transmembrane protein 8C,
• Gene location: 9q34.2 (133524958: 133514585)     Exons: 5     NC_000009.12
• OMIM: 151990

Protein Summary

• Protein general information: A6NI61  
  • Name: Protein myomaker (Myoblast fusion maker) (Transmembrane protein 226) (Transmembrane protein 8C)
  • Length: 221  
  • Mass: 24699
• Sequence:

  MGTLVAKLLLPTLSSLAFLPTVSIAAKRRFHMEAMVYLFTLFFVALHHACNGPGLSVLCFMRHDILEYFSVYGTA
  LSMWVSLMALADFDEPKRSTFVMFGVLTIAVRIYHDRWGYGVYSGPIGTAILIIAAKWLQKMKEKKGLYPDKSVY
  TQQIGPGLCFGALALMLRFFFEDWDYTYVHSFYHCALAMSFVLLLPKVNKKAGSPGTPAKLDCSTLCCACV

• Structural information:
  • Interpro: IPR021910  
  • STRING: ENSP00000419712
• Other Databases: GeneCards:  MYMK  Malacards:  MYMK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0007520	myoblast fusion	IDA	biological process
GO:0045026	plasma membrane fusion	ISS	biological process
GO:0007520	myoblast fusion	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0030173	integral component of Golgi membrane	ISS	cellular component
GO:1904206	positive regulation of skeletal muscle hypertrophy	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007517	muscle organ development	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007520	myoblast fusion	IEA	biological process
GO:0014905	myoblast fusion involved in skeletal muscle regeneration	IEA	biological process
GO:0030173	integral component of Golgi membrane	IEA	cellular component
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0045026	plasma membrane fusion	IEA	biological process
GO:1904206	positive regulation of skeletal muscle hypertrophy	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Carey-Fineman-Ziter syndrome	KEGG:H01908
Carey-Fineman-Ziter syndrome	KEGG:H01908
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq