• Gene id: 389816

Gene Summary

• Gene Symbol: LRRC26   Gene   UCSC   Ensembl
• Aliases: CAPC, bA350O14.10
• Gene name: leucine rich repeat containing 26
• Alternate names: leucine-rich repeat-containing protein 26, BK channel auxiliary gamma subunit LRRC26, BK channel auxilliary gamma subunit LRRC26, cytokeratin associated protein, cytokeratin-associated protein in cancer,
• Gene location: 9q34.3 (137170038: 137168757)     Exons: 2     NC_000009.12
• OMIM: 613505

Protein Summary

• Protein general information: Q2I0M4  
  • Name: Leucine rich repeat containing protein 26 (BK channel auxiliary gamma subunit LRRC26) (Cytokeratin associated protein in cancer)
  • Length: 334  
  • Mass: 34857
  • Tissue specificity: Isoform 1 is expressed highly in normal prostate and salivary gland, very weakly in colon, pancreas, and intestine, and not at all in other tissues. Isoform 1 is expressed highly in many cancer cell lines and in breast cancer, pancreat
• Sequence:

  MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSALSLPAVPPGLSLRLRA
  LLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLEALAPGTFAPLRALRNLSL
  AGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASE
  AETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTA
  ALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA

• Structural information:
  • Protein Domains: (34..7-)
    (/note="LRRNT-)
    (201..25-)
    (/note="LRRCT"-)
  • Interpro: IPR001611  IPR003591  IPR032675  
  • DIP: 60459
  • STRING: ENSP00000360597
• Other Databases: GeneCards:  LRRC26  Malacards:  LRRC26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005249	voltage-gated potassium channel activity	IBA	molecular function
GO:0008076	voltage-gated potassium channel complex	IBA	cellular component
GO:0099104	potassium channel activator activity	IBA	molecular function
GO:0044325	ion channel binding	IBA	molecular function
GO:0015459	potassium channel regulator activity	IDA	molecular function
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0008076	voltage-gated potassium channel complex	IDA	cellular component
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0099104	potassium channel activator activity	IDA	molecular function
GO:0005249	voltage-gated potassium channel activity	IDA	molecular function
GO:1903818	positive regulation of voltage-gated potassium channel activity	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq