• Gene id: 389658

Gene Summary

• Gene Symbol: ALKAL1   Gene   UCSC   Ensembl
• Aliases: AUGA, AUGB, FAM150A, UNQ9433
• Gene name: ALK and LTK ligand 1
• Alternate names: ALK and LTK ligand 1, AUG-beta, RPLK9433, augmentor beta, augmentor-alpha, family with sequence similarity 150 member A, protein FAM150A,
• Gene location: 8q11.23 (52565429: 52534036)     Exons: 5     NC_000008.11
• OMIM: 617658

Protein Summary

• Protein general information: Q6UXT8  
  • Name: ALK and LTK ligand 1 (Augmentor beta) (AUG beta) (Protein FAM150A)
  • Length: 129  
  • Mass: 14269
  • Tissue specificity: Widely expressed with highest levels in thyroid and moderate levels in stomach, trachea, small intestine, prostate and brain. {ECO
• Sequence:

  MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDK
  FIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT

• Structural information:
  • Interpro: IPR029364  
  • STRING: ENSP00000351345
• Other Databases: GeneCards:  ALKAL1  Malacards:  ALKAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IBA	molecular function
GO:0070378	positive regulation of ERK5 cascade	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IDA	molecular function
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070378	positive regulation of ERK5 cascade	IDA	biological process
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IEA	molecular function
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881