• Gene id: 389421

Gene Summary

• Gene Symbol: LIN28B   Gene   UCSC   Ensembl
• Aliases: CSDD2
• Gene name: lin-28 homolog B
• Alternate names: protein lin-28 homolog B, Lin-28.2, lin-28B,
• Gene location: 6q16.3-q21 (104936998: 105083331)     Exons: 7     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumor
• OMIM: 611044

Protein Summary

• Protein general information: Q6ZN17  
  • Name: Protein lin 28 homolog B (Lin 28B)
  • Length: 250  
  • Mass: 27,084
• Sequence:

  MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPVDVFVHQSKLFMEGFR
  SLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPKGDRCYNCGGLDHHAKECSLPPQPKK
  CHYCQSIMHMVANCPHKNVAQPPASSQGRQEAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEA
  SSTKSSIAPEEQSKKGPSVQKRKKT

• Structural information:
  • Protein Domains: CSD. (29-102)
  • Interpro: IPR011129  IPR002059  IPR012340  IPR001878  IPR036875  
  • Prosite: PS51857 PS50158
  • CDD: cd04458
  • PDB: 4A4I
  • PDBsum: 4A4I
  • STRING: ENSP00000344401
• Other Databases: GeneCards:  LIN28B  Malacards:  LIN28B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0031123	RNA 3'-end processing	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0031123	RNA 3'-end processing	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010587	miRNA catabolic process	IMP	biological process
GO:0031054	pre-miRNA processing	IMP	biological process
GO:0031123	RNA 3'-end processing	IMP	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function

Diseases

Associated diseases	References
Crohn's disease	GAD: 20846217
Obesity	GAD: 21102462
Globozoospermia	MIK: 25762640
Azoospermia	MIK: 25762640
Male factor infertility	MIK: 25762640
Azoospermia	MIK: 25762640
Globozoospermia	MIK: 25762640

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25762640	Azoospermia, Globozoospermia				Male infertility	GDAP1L1 GNAS KCNK9 LIN28B RB1 RTL1 SLC22A18 ZDBF2