• Gene id: 389376

Gene Summary

• Gene Symbol: SFTA2   Gene   UCSC   Ensembl
• Aliases: GSGL541, SFTPG, SP-G, UNQ541
• Gene name: surfactant associated 2
• Alternate names: surfactant-associated protein 2, surfactant associated protein G,
• Gene location: 6p21.33 (30932169: 30931352)     Exons: 3     NC_000006.12
• OMIM: 606365

Protein Summary

• Protein general information: Q6UW10  
  • Name: Surfactant associated protein 2 (Surfactant associated protein G) (SP G)
  • Length: 78  
  • Mass: 8396
  • Tissue specificity: Predominantly expressed in lung, where it is detected in type II pneumocytes in the alveolus, and in nonciliated epithelium in bronchioli (at protein level). Also detected at lower levels in cervix, esophagus, stomach, testis and kidne
• Sequence:

  MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVV
  CNT

• Structural information:
  • Interpro: IPR028198  
  • STRING: ENSP00000351989
• Other Databases: GeneCards:  SFTA2  Malacards:  SFTA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030133	transport vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881