• Gene id: 389119

Gene Summary

• Gene Symbol: INKA1   Gene   UCSC   Ensembl
• Aliases: C3orf54, FAM212A
• Gene name: inka box actin regulator 1
• Alternate names: PAK4-inhibitor INKA1, HInca, Induced in Neural Crest by AP-2alpha, family with sequence similarity 212 member A, induced in neural crest by AP2-alpha protein homolog, protein FAM212A,
• Gene location: 3p21.31 (124941406: 124878274)     Exons: 23     NC_000009.12

Protein Summary

• Protein general information: Q96EL1  
  • Name: PAK4 inhibitor INKA1 (Induced in neural crest by AP2 alpha protein homolog) (HInca) (Inka box actin regulator 1)
  • Length: 287  
  • Mass: 31574
• Sequence:

  MDMHSARLDSFLSQLRWELLCGRDTGSPSMPGPLQPTSQTGPDVQPSHQLRASGALEEDSVCCVEEEEEEEEEAV
  VTEDRDAALGGPREHALDWDSGFSEVSGSTWREEELPVSQRPAPSAQPLRRQCLSVSGLPMPSRAPVASVPPVHH
  PRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPETGSEGGDGGGHRARARPPQF
  LLGLSEQLRRRLARARRTAMAGKRLSCPPRPEPELPADVSRFAALMSCRSRQPIICNDVSYL

• Structural information:
  • Interpro: IPR029267  IPR039201  
  • PDB: 4XBR 4XBU
  • PDBsum: 4XBR 4XBU
  • STRING: ENSP00000329735
• Other Databases: GeneCards:  INKA1  Malacards:  INKA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030291	protein serine/threonine kinase inhibitor activity	IBA	molecular function
GO:0019901	protein kinase binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0030291	protein serine/threonine kinase inhibitor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030291	protein serine/threonine kinase inhibitor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021915	neural tube development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881