• Gene id: 389084

Gene Summary

• Gene Symbol: SNORC   Gene   UCSC   Ensembl
• Aliases: ASCL830, C2orf82, UNQ830
• Gene name: secondary ossification center associated regulator of chondrocyte maturation
• Alternate names: protein SNORC, Small Novel Rich in Cartilage, secondary ossification center-associated regulator of chondrocyte maturation protein, uncharacterized protein C2orf82,
• Gene location: 2q37.1 (232865677: 232878703)     Exons: 9     NC_000002.12
• OMIM: 610169

Protein Summary

• Protein general information: Q6UX34  
  • Name: Protein SNORC (Secondary ossification center associated regulator of chondrocyte maturation protein)
  • Length: 121  
  • Mass: 12073
  • Tissue specificity: Expressed in cartilage. {ECO
• Sequence:

  MASCLALRMALLLVSGVLAPAVLTDDVPQEPVPTLWNEPAELPSGEGPVESTSPGREPVDTGPPAPTVAPGPEDS
  TAQERLDQGGGSLGPGAIAAIVIAALLATCVVLALVVVALRKFSAS

• Structural information:
  • Interpro: IPR031500  
  • STRING: ENSP00000386804
• Other Databases: GeneCards:  SNORC  Malacards:  SNORC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071944	cell periphery	IBA	cellular component
GO:0051216	cartilage development	ISS	biological process
GO:0071944	cell periphery	ISS	cellular component
GO:0051216	cartilage development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071944	cell periphery	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0051216	cartilage development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray