• Gene id: 389

Gene Summary

• Gene Symbol: RHOC   Gene   UCSC   Ensembl
• Aliases: ARH9, ARHC, H9, RHOH9
• Gene name: ras homolog family member C
• Alternate names: rho-related GTP-binding protein RhoC, RAS-related homolog 9, epididymis secretory sperm binding protein, oncogene RHO H9, ras homolog gene family, member C, rho cDNA clone 9, rhoC GTPase, small GTP binding protein RhoC,
• Gene location: 1p13.2 (112707402: 112701126)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskel
• OMIM: 611477

Protein Summary

• Protein general information: P08134  
  • Name: Rho related GTP binding protein RhoC (Rho cDNA clone 9) (h9)
  • Length: 193  
  • Mass: 22006
• Sequence:

  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYP
  DTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANR
  ISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • PDB: 1Z2C 2GCN 2GCO 2GCP
  • PDBsum: 1Z2C 2GCN 2GCO 2GCP
  • STRING: ENSP00000285735
• Other Databases: GeneCards:  RHOC  Malacards:  RHOC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043005	neuron projection	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0043297	apical junction assembly	IDA	biological process
GO:0032154	cleavage furrow	IDA	cellular component
GO:0000281	mitotic cytokinesis	IDA	biological process
GO:0031334	positive regulation of protein-containing complex assembly	ISS	biological process
GO:0032420	stereocilium	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0060193	positive regulation of lipase activity	IDA	biological process
GO:0044319	wound healing, spreading of cells	ISS	biological process
GO:0044319	wound healing, spreading of cells	ISS	biological process
GO:1902766	skeletal muscle satellite cell migration	ISS	biological process
GO:1902766	skeletal muscle satellite cell migration	ISS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Breast cancer	PMID:12237774
ovarian carcinoma	PMID:12808121
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881