About Us

Search Result


Gene id 388799
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol FAM209B   Gene   UCSC   Ensembl
Aliases C20orf107, dJ1153D9.4
Gene name family with sequence similarity 209 member B
Alternate names protein FAM209B, uncharacterized protein C20orf107,
Gene location 20q13.31 (56527123: 56555625)     Exons: 5     NC_000020.11

Protein Summary

Protein general information Q5JX69  

Name: Protein FAM209B

Length: 171  Mass: 19499

Sequence MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVPCGEHFRIRQNLPEHTQGWLGSKWLWLLFAVVPFVILQC
QRDSEKNKEQSPPGLRGFPFRTPLKKNQNASLYKDCVFNTLNELEVELLKFVSEVQNLKGAMATGSGSNLKLRRS
EMPADPYHVTICKIWGEESSS
Structural information
Interpro:  IPR027943  
STRING:   ENSP00000360376
Other Databases GeneCards:  FAM209B  Malacards:  FAM209B

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0005634 nucleus
HDA cellular component
Associated diseases References
Non obstructive azoospermia MIK: 24012201
Sertoli cell only syndrome MIK: 23869807

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
24012201 Non obstru
ctive azoo
spermia

31 (4 controls,
27 cases)
Male infertility GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
23869807 Non obstru
ctive azoo
spermia, S
ertoli cel
l only syn
drome

20 (4 controls,
16 cases)
Male infertility GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract