• Gene id: 388799

Gene Summary

• Gene Symbol: FAM209B   Gene   UCSC   Ensembl
• Aliases: C20orf107, dJ1153D9.4
• Gene name: family with sequence similarity 209 member B
• Alternate names: protein FAM209B, uncharacterized protein C20orf107,
• Gene location: 20q13.31 (56527123: 56555625)     Exons: 5     NC_000020.11

Protein Summary

• Protein general information: Q5JX69  
  • Name: Protein FAM209B
  • Length: 171  
  • Mass: 19499
• Sequence:

  MWTLKSSLVLLLCLTCSYAFMFSSLRQKTSEPQGKVPCGEHFRIRQNLPEHTQGWLGSKWLWLLFAVVPFVILQC
  QRDSEKNKEQSPPGLRGFPFRTPLKKNQNASLYKDCVFNTLNELEVELLKFVSEVQNLKGAMATGSGSNLKLRRS
  EMPADPYHVTICKIWGEESSS

• Structural information:
  • Interpro: IPR027943  
  • STRING: ENSP00000360376
• Other Databases: GeneCards:  FAM209B  Malacards:  FAM209B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)