About Us

Search Result


Gene id 388753
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol COA6   Gene   UCSC   Ensembl
Aliases C1orf31, CEMCOX4
Gene name cytochrome c oxidase assembly factor 6
Alternate names cytochrome c oxidase assembly factor 6 homolog,
Gene location 1q42.2 (234373436: 234384048)     Exons: 4     NC_000001.11
Gene summary(Entrez) This gene encodes a member of the cytochrome c oxidase subunit 6B family. The encoded protein associates with cytochrome c oxidase may act has an cytochrome c oxidase mitochondrial respiratory complex VI assembly factor. Mutations in this gene may be asso
OMIM 614772

Protein Summary

Protein general information Q5JTJ3  

Name: Cytochrome c oxidase assembly factor 6 homolog

Length: 125  Mass: 14,116

Sequence MGPGGPLLSPSRGFLLCKTGWHSNRLLGDCGPHTPVSTALSFIAVGMAAPSMKERQVCWGARDEYWKCLDENLED
ASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS
Structural information
Protein Domains
CHCH. (55-98)
Interpro:  IPR003213  IPR036549  
Prosite:   PS51808
CDD:   cd00926
STRING:   ENSP00000355572
Other Databases GeneCards:  COA6  Malacards:  COA6

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0004129 cytochrome-c oxidase acti
vity
IEA molecular function
GO:0005507 copper ion binding
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005739 mitochondrion
ISS cellular component
GO:0005758 mitochondrial intermembra
ne space
IDA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0008535 respiratory chain complex
IV assembly
IMP biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0044822 poly(A) RNA binding
IDA molecular function
GO:1902600 hydrogen ion transmembran
e transport
IEA biological process
GO:0004129 cytochrome-c oxidase acti
vity
IEA molecular function
GO:0005507 copper ion binding
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005739 mitochondrion
IEA cellular component
GO:0005739 mitochondrion
ISS cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005758 mitochondrial intermembra
ne space
IEA cellular component
GO:0005758 mitochondrial intermembra
ne space
IDA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0008535 respiratory chain complex
IV assembly
IMP biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0044822 poly(A) RNA binding
IDA molecular function
GO:1902600 hydrogen ion transmembran
e transport
IEA biological process
GO:0005507 copper ion binding
IDA molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005739 mitochondrion
ISS cellular component
GO:0005758 mitochondrial intermembra
ne space
IDA cellular component
GO:0008535 respiratory chain complex
IV assembly
IMP biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0008535 respiratory chain complex
IV assembly
IDA biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0042774 plasma membrane ATP synth
esis coupled electron tra
nsport
IMP biological process
GO:0044822 poly(A) RNA binding
IDA molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04714Thermogenesis
Associated diseases References
Cardioencephalomyopathy OMIM: 614772
Asthenozoospermia MIK: 25825237
Asthenozoospermia MIK: 25825237
Asthenozoospermia MIK: 25825237
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
25825237 Asthenozoo
spermia


Male infertility Tubulin beta 2B; glutathione S-transferase�Mu�3; keratin
type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B;�sperm�protein associated with t
Show abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract