• Gene id: 388551

Gene Summary

• Gene Symbol: CEACAM16   Gene   UCSC   Ensembl
• Aliases: CEAL2, DFNA4B, DFNB113
• Gene name: CEA cell adhesion molecule 16, tectorial membrane component
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 16, carcinoembryonic antigen like-2 protein, carcinoembryonic antigen related cell adhesion molecule 16,
• Gene location: 19q13.31-q13.32 (44699150: 44710717)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over a

Protein Summary

• Protein general information: Q2WEN9  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 16 (Carcinoembryonic antigen like 2)
  • Length: 425  
  • Mass: 45873
• Sequence:

  MALTGYSWLLLSATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIVSTGDE
  TPGPAHTGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILAQPTVLANSTALVERRDTLR
  LMCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGIRREEAGAYQCEVWNPVSVSRSEPINLTVYFGPER
  VAILQDSTTRTGCTIKVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTYTCIAKNTKT
  LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPA
  HTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG

• Structural information:
  • Protein Domains: (133..21-)
    1 (/note="Ig-like-C2-type)
    (223..30-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • STRING: ENSP00000466561
• Other Databases: GeneCards:  CEACAM16  Malacards:  CEACAM16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007605	sensory perception of sound	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0032426	stereocilium tip	IBA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0032426	stereocilium tip	ISS	cellular component
GO:0007605	sensory perception of sound	IMP	biological process
GO:0007605	sensory perception of sound	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007605	sensory perception of sound	IMP	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0032426	stereocilium tip	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Deafness, autosomal dominant	KEGG:H00604
Deafness, autosomal dominant	KEGG:H00604
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq