• Gene id: 388533

Gene Summary

• Gene Symbol: KRTDAP   Gene   UCSC   Ensembl
• Aliases: KDAP, UNQ467
• Gene name: keratinocyte differentiation associated protein
• Alternate names: keratinocyte differentiation-associated protein, KIPV467,
• Gene location: 19q13.12 (35490463: 35487323)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a protein which may function in the regulation of keratinocyte differentiation and maintenance of stratified epithelia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011

Protein Summary

• Protein general information: P60985  
  • Name: Keratinocyte differentiation associated protein
  • Length: 99  
  • Mass: 11050
  • Tissue specificity: Highly expressed in skin and detected at lower levels in thymus. In skin, found exclusively in lamellar granules of granular keratinocytes and in the intracellular space of the stratum corneum. Also highly expressed in oral mucosa, ton
• Sequence:

  MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALFESIKR
  KLPFLNWDAFPKLKGLRSATPDAQ

• Structural information:
  • Interpro: IPR028196  
  • STRING: ENSP00000339251
• Other Databases: GeneCards:  KRTDAP  Malacards:  KRTDAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008544	epidermis development	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0042599	lamellar body	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq