• Gene id: 388336

Gene Summary

• Gene Symbol: SHISA6   Gene   UCSC   Ensembl
• Gene name: shisa family member 6
• Alternate names: protein shisa-6, protein shisa-6 homolog, shisa homolog 6,
• Gene location: 17p12 (11241212: 11564062)     Exons: 6     NC_000017.11

Protein Summary

• Protein general information: Q6ZSJ9  
  • Name: Protein shisa 6
  • Length: 500  
  • Mass: 55764
  • Tissue specificity: Expressed in the developing ventral mesencephalon. {ECO
• Sequence:

  MALRRLLLLLLLSLESLDLLPSVHGARGRAANRTLSAGGAAVGGRRAGGALARGGRELNGTARAPGIPEAGSRRG
  QPAAAVAAAASAAVTYETCWGYYDVSGQYDKEFECNNSESGYLYCCGTCYYRFCCKKRHEKLDQRQCTNYQSPVW
  VQTPSTKVVSPGPENKYDPEKDKTNFTVYITCGVIAFVIVAGVFAKVSYDKAHRPPREMNIHRALADILRQQGPI
  PIAHCERETISAIDTSPKENTPVRSSSKNHYTPVRTAKQTPEKPRMNNILTSATEPYDLSFSRSFQNLAHLPPSY
  ESAVKTNPSKYSSLKRLTDKEADEYYMRRRHLPDLAARGTLPLNVIQMSQQKPLPRERPRRPIRAMSQDRVLSPD
  RGLPDEFSMPYDRILSDEQLLSTERLHSQDPLLSPERTAFPEQSLSRAISHTDVFVSTPVLDRYRMSKMHSHPSA
  SNNSYATLGQSQTAAKRHAFASRRHNTVEQLHYIPGHHTCYTASKTEVTV

• Structural information:
  • Interpro: IPR026910  
  • STRING: ENSP00000390084
• Other Databases: GeneCards:  SHISA6  Malacards:  SHISA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032591	dendritic spine membrane	IBA	cellular component
GO:0014069	postsynaptic density	IBA	cellular component
GO:0032281	AMPA glutamate receptor complex	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0048172	regulation of short-term neuronal synaptic plasticity	IBA	biological process
GO:2000311	regulation of AMPA receptor activity	IBA	biological process
GO:0098985	asymmetric, glutamatergic, excitatory synapse	ISS	cellular component
GO:0035255	ionotropic glutamate receptor binding	ISS	molecular function
GO:0098976	excitatory chemical synaptic transmission	ISS	biological process
GO:0007283	spermatogenesis	ISS	biological process
GO:0014069	postsynaptic density	ISS	cellular component
GO:1904717	regulation of AMPA glutamate receptor clustering	ISS	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0030165	PDZ domain binding	IEA	molecular function
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0098970	postsynaptic neurotransmitter receptor diffusion trapping	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:1904717	regulation of AMPA glutamate receptor clustering	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0098962	regulation of postsynaptic neurotransmitter receptor activity	IEA	biological process
GO:0098976	excitatory chemical synaptic transmission	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098985	asymmetric, glutamatergic, excitatory synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq