• Gene id: 387990

Gene Summary

• Gene Symbol: TOMM20L   Gene   UCSC   Ensembl
• Aliases: UNQ9438
• Gene name: translocase of outer mitochondrial membrane 20 like
• Alternate names: TOMM20-like protein 1, translocase of outer mitochondrial membrane 20 homolog type I, translocase of outer mitochondrial membrane 20 homolog-like,
• Gene location: 14q23.1 (58395903: 58417079)     Exons: 6     NC_000014.9
• OMIM: 605863

Protein Summary

• Protein general information: Q6UXN7  
  • Name: TOMM20 like protein 1
  • Length: 152  
  • Mass: 17700
• Sequence:

  MPSVRSLLRLLAAAAACGAFAFLGYCIYLNRKRRGDPAFKRRLRDKRRAEPQKAEEQGTQLWDPTKNKKLQELFL
  QEVRMGELWLSRGEHRMGIQHLGNALLVCEQPRELLKVFKHTLPPKVFEMLLHKIPLICQQFEADMNEQDCLEDD
  PD

• Structural information:
  • Interpro: IPR002056  IPR022422  IPR023392  
  • STRING: ENSP00000354204
• Other Databases: GeneCards:  TOMM20L  Malacards:  TOMM20L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005742	mitochondrial outer membrane translocase complex	IBA	cellular component
GO:0016031	tRNA import into mitochondrion	IBA	biological process
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0030943	mitochondrion targeting sequence binding	IBA	molecular function
GO:0031307	integral component of mitochondrial outer membrane	IBA	cellular component
GO:0070096	mitochondrial outer membrane translocase complex assembly	IBA	biological process
GO:0005742	mitochondrial outer membrane translocase complex	IEA	cellular component
GO:0006605	protein targeting	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005741	mitochondrial outer membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881