• Gene id: 387882

Gene Summary

• Gene Symbol: C12orf75   Gene   UCSC   Ensembl
• Aliases: AGD3, OCC-1, OCC1
• Gene name: chromosome 12 open reading frame 75
• Alternate names: overexpressed in colon carcinoma 1 protein, adipogenesis down-regulated 3, overexpressed in colon carcinoma-1, putative overexpressed in colon carcinoma-1 protein variant C,
• Gene location: 12q23.3 (105330690: 105371517)     Exons: 6     NC_000012.12
• OMIM: 0

Protein Summary

• Protein general information: Q8TAD7  
  • Name: Overexpressed in colon carcinoma 1 protein (OCC 1) (AGD3)
  • Length: 63  
  • Mass: 6407
  • Tissue specificity: High expression in placenta, skeletal muscle, kidney and pancreas tissues. Absent or very faint expression in heart, brain, lung and liver. Expressed during adipogenic differentiation of mesenchymal stem cells (at protein level). {ECO
• Sequence:

  MGCGNSTATSAGAGQGPAGAAKDVTEESVTEDDKRRNYGGVYVGLPSEAVNMVSSQTKTVRKN

• Structural information:
  • Interpro: IPR029133  
  • STRING: ENSP00000448536
• Other Databases: GeneCards:  C12orf75  Malacards:  C12orf75

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)