• Gene id: 3875

Gene Summary

• Gene Symbol: KRT18   Gene   UCSC   Ensembl
• Aliases: CK-18, CYK18, K18
• Gene name: keratin 18
• Alternate names: keratin, type I cytoskeletal 18, cell proliferation-inducing gene 46 protein, cytokeratin 18, keratin 18, type I,
• Gene location: 12q13.13 (52948870: 52952905)     Exons: 8     NC_000012.12
• Gene summary(Entrez): KRT18 encodes the type I intermediate filament chain keratin 18. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial
• OMIM: 148070

Protein Summary

• Protein general information: P05783  
  • Name: Keratin, type I cytoskeletal 18 (Cell proliferation inducing gene 46 protein) (Cytokeratin 18) (CK 18) (Keratin 18) (K18)
  • Length: 430  
  • Mass: 48058
  • Tissue specificity: Expressed in colon, placenta, liver and very weakly in exocervix. Increased expression observed in lymph nodes of breast carcinoma. {ECO
• Sequence:

  MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMG
  GIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARI
  VLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQ
  AQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELR
  RTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEA
  EIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH

• Structural information:
  • Protein Domains: (80..39-)
    (/note="IF-rod)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01188"-)
  • Interpro: IPR018039  IPR039008  IPR042180  IPR027695  IPR002957  
  • Prosite: PS00226 PS51842
  • DIP: 633
  • STRING: ENSP00000373487
• Other Databases: GeneCards:  KRT18  Malacards:  KRT18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005882	intermediate filament	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005882	intermediate filament	TAS	cellular component
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031424	keratinization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005882	intermediate filament	IEA	cellular component
GO:0045095	keratin filament	IEA	cellular component
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0045095	keratin filament	IEA	cellular component
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0098641	cadherin binding involved in cell-cell adhesion	HDA	molecular function
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005882	intermediate filament	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005912	adherens junction	HDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0043000	Golgi to plasma membrane CFTR protein transport	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0045095	keratin filament	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045104	intermediate filament cytoskeleton organization	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Familial cirrhosis	KEGG:H02225
Familial cirrhosis	KEGG:H02225
Non-alcoholic fatty liver disease	PMID:30089409
Non-alcoholic steatohepatitis	PMID:21993925
Primary biliary cirrhosis	PMID:26110613
Liver disease	PMID:17306787
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881