• Gene id: 387332

Gene Summary

• Gene Symbol: TBPL2   Gene   UCSC   Ensembl
• Aliases: TBP2, TRF3
• Gene name: TATA-box binding protein like 2
• Alternate names: TATA box-binding protein-like protein 2, TATA box-binding protein-related factor 3, TBP-like protein 2, TBP-related factor 3,
• Gene location: 14q22.3 (55440544: 55414209)     Exons: 7     NC_000014.9
• OMIM: 608964

Protein Summary

• Protein general information: Q6SJ96  
  • Name: TATA box binding protein like protein 2 (TBP like protein 2) (TATA box binding protein related factor 3) (TBP related factor 3)
  • Length: 375  
  • Mass: 41524
  • Tissue specificity: Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes. {ECO
• Sequence:

  MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMYILNAS
  NPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQDVGLGLNSSS
  LSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAK
  NAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCD
  VRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA

• Structural information:
  • Interpro: IPR000814  IPR030491  IPR012295  IPR033710  
  • Prosite: PS00351
  • CDD: cd04516
  • STRING: ENSP00000247219
• Other Databases: GeneCards:  TBPL2  Malacards:  TBPL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0001016	RNA polymerase III transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IBA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000126	transcription factor TFIIIB complex	IBA	cellular component
GO:0070898	RNA polymerase III preinitiation complex assembly	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05016	Huntington disease
hsa05165	Human papillomavirus infection
hsa05166	Human T-cell leukemia virus 1 infection
hsa05203	Viral carcinogenesis
hsa05017	Spinocerebellar ataxia
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881