• Gene id: 387103

Gene Summary

• Gene Symbol: CENPW   Gene   UCSC   Ensembl
• Aliases: C6orf173, CENP-W, CUG2
• Gene name: centromere protein W
• Alternate names: centromere protein W, cancer-up-regulated gene 2 protein, cancer-upregulated gene 2,
• Gene location: 6q22.32 (126339695: 126483319)     Exons: 5     NC_000006.12
• OMIM: 611264

Protein Summary

• Protein general information: Q5EE01  
  • Name: Centromere protein W (CENP W) (Cancer up regulated gene 2 protein)
  • Length: 88  
  • Mass: 10061
  • Tissue specificity: Highly expressed in ovary, liver, lung and pancreas and to a lower extent in breast and gastrointestinal tract cancers; such as those of the colon, rectum and stomach. Overexpressed in high grade breast invasive tumors. Expressed in ma
• Sequence:

  MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHV
  LAAAKVILKKSRG

• Structural information:
  • Interpro: IPR028847  IPR009072  
• Other Databases: GeneCards:  CENPW  Malacards:  CENPW

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0000776	kinetochore	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0051382	kinetochore assembly	IBA	biological process
GO:0051225	spindle assembly	IBA	biological process
GO:0007059	chromosome segregation	IBA	biological process
GO:0000775	chromosome, centromeric region	IBA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0051382	kinetochore assembly	IMP	biological process
GO:0051276	chromosome organization	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0051382	kinetochore assembly	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0007059	chromosome segregation	TAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)