• Gene id: 386746

Gene Summary

• Gene Symbol: MRGPRG   Gene   UCSC   Ensembl
• Aliases: GPR169, MRGG
• Gene name: MAS related GPR family member G
• Alternate names: mas-related G-protein coupled receptor member G, G protein-coupled receptor 169, G protein-coupled receptor MRGG,
• Gene location: 11p15.4 (3218812: 3217943)     Exons: 1     NC_000011.10

Protein Summary

• Protein general information: Q86SM5  
  • Name: Mas related G protein coupled receptor member G (G protein coupled receptor 169)
  • Length: 289  
  • Mass: 31518
• Sequence:

  MFGLFGLWRTFDSVVFYLTLIVGLGGPVGNGLVLWNLGFRIKKGPFSIYLLHLAAADFLFLSCRVGFSVAQAALG
  AQDTLYFVLTFLWFAVGLWLLAAFSVERCLSDLFPACYQGCRPRHASAVLCALVWTPTLPAVPLPANACGLLRNS
  ACPLVCPRYHVASVTWFLVLARVAWTAGVVLFVWVTCCSTRPRPRLYGIVLGALLLLFFCGLPSVFYWSLQPLLN
  FLLPVFSPLATLLACVNSSSKPLIYSGLGRQPGKREPLRSVLRRALGEGAELGARGQSLPMGLL

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR026234  IPR027336  
  • Prosite: PS50262
  • CDD: cd15111
  • STRING: ENSP00000330612
• Other Databases: GeneCards:  MRGPRG  Malacards:  MRGPRG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray