• Gene id: 386682

Gene Summary

• Gene Symbol: KRTAP10-3   Gene   UCSC   Ensembl
• Aliases: KAP10.3, KAP18-3, KAP18.3, KRTAP10.3, KRTAP18-3, KRTAP18.3
• Gene name: keratin associated protein 10-3
• Alternate names: keratin-associated protein 10-3, high sulfur keratin-associated protein 10.3, keratin-associated protein 18-3, keratin-associated protein 18.3,
• Gene location: 21q22.3 (44558794: 44557789)     Exons: 1     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino-
• OMIM: 607234

Protein Summary

• Protein general information: P60369  
  • Name: Keratin associated protein 10 3 (High sulfur keratin associated protein 10.3) (Keratin associated protein 10.3) (Keratin associated protein 18 3) (Keratin associated protein 18.3)
  • Length: 221  
  • Mass: 22348
  • Tissue specificity: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO
• Sequence:

  MATSTMSVCSSAYSDSWQVDACPESCCEPPCCATSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSPCQSGCTSSC
  TPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCKPVCCKPICCVPVCSGASSSCCQQSSRQPACCTTS
  CCRPSSSVSLLCRPVCRSTCCVPIPSCCAPASTCQPSCCRPASCVSLLCRPTCSRLSSACCGLSSGQKSSC

• Structural information:
  • Interpro: IPR002494  
  • STRING: ENSP00000375478
• Other Databases: GeneCards:  KRTAP10-3  Malacards:  KRTAP10-3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045095	keratin filament	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0031424	keratinization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq