• Gene id: 3861

Gene Summary

• Gene Symbol: KRT14   Gene   UCSC   Ensembl
• Aliases: CK14, EBS3, EBS4, K14, NFJ
• Gene name: keratin 14
• Alternate names: keratin, type I cytoskeletal 14, cytokeratin 14, keratin 14, type I,
• Gene location: 17q21.2 (41586894: 41582278)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskele

Protein Summary

• Protein general information: P02533  
  • Name: Keratin, type I cytoskeletal 14 (Cytokeratin 14) (CK 14) (Keratin 14) (K14)
  • Length: 472  
  • Mass: 51561
  • Tissue specificity: Detected in the basal layer, lowered within the more apically located layers specifically in the stratum spinosum, stratum granulosum but is not detected in stratum corneum. Strongly expressed in the outer root sheath of anagen follicl
• Sequence:

  MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYGGGFSS
  SSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDW
  YQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVL
  DELTLARADLEMQIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRK
  DAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQE
  MIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRT
  KVMDVHDGKVVSTHEQVLRTKN

• Structural information:
  • Protein Domains: (115..42-)
    (/note="IF-rod)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01188"-)
  • Interpro: IPR018039  IPR039008  IPR042180  IPR002957  
  • Prosite: PS00226 PS51842
  • PDB: 3TNU 6JFV
  • PDBsum: 3TNU 6JFV
  • DIP: 33874
  • STRING: ENSP00000167586
• Other Databases: GeneCards:  KRT14  Malacards:  KRT14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	TAS	molecular function
GO:0008544	epidermis development	TAS	biological process
GO:0045095	keratin filament	IDA	cellular component
GO:0031424	keratinization	TAS	biological process
GO:0031581	hemidesmosome assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010043	response to zinc ion	IEA	biological process
GO:0071944	cell periphery	IEA	cellular component
GO:0045178	basal part of cell	IEA	cellular component
GO:0045095	keratin filament	IEA	cellular component
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0010212	response to ionizing radiation	IEA	biological process
GO:0045095	keratin filament	IEA	cellular component
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0005882	intermediate filament	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0042633	hair cycle	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007568	aging	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0045110	intermediate filament bundle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1990254	keratin filament binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Epidermolysis bullosa simplex	KEGG:H00584
Naegeli-Franceschetti-Jadassohn syndrome	KEGG:H00708
Dermatopathia pigmentosa reticularis	KEGG:H00796
Epidermolysis bullosa simplex	KEGG:H00584
Naegeli-Franceschetti-Jadassohn syndrome	KEGG:H00708
Dermatopathia pigmentosa reticularis	KEGG:H00796
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq