• Gene id: 3858

Gene Summary

• Gene Symbol: KRT10   Gene   UCSC   Ensembl
• Aliases: BCIE, BIE, CK10, EHK, K10, KPP
• Gene name: keratin 10
• Alternate names: keratin, type I cytoskeletal 10, CK-10, cytokeratin 10, keratin 10, type I,
• Gene location: 17q21.2 (40822620: 40818116)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along wi
• OMIM: 148080

Protein Summary

• Protein general information: P13645  
  • Name: Keratin, type I cytoskeletal 10 (Cytokeratin 10) (CK 10) (Keratin 10) (K10)
  • Length: 584  
  • Mass: 58,827
• Sequence:

  MSVRYSSSKHYSSSRSGGGGGGGGCGGGGGVSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGGCFGGSSGGYG
  GLGGFGGGSFRGSYGSSSFGGSYGGIFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTM
  QNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYYKTIDDLKNQILNLTTDNANILLQID
  NARLAADDFRLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTG
  DVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQAL
  EIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYR
  SLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGHGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGS
  SSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY

• Structural information:
  • Protein Domains: IF (146-460)
  • Interpro: IPR001664  IPR018039  IPR002957  
  • Prosite: PS00226 PS51842
  • PDB: 3ASW 4F1Z 4ZRY
  • PDBsum: 3ASW 4F1Z 4ZRY
  • STRING: ENSP00000269576
• Other Databases: GeneCards:  KRT10  Malacards:  KRT10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005882	intermediate filament	NAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0030280	structural constituent of epidermis	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005198	structural molecule activity	IEA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0005882	intermediate filament	NAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0030280	structural constituent of epidermis	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005882	intermediate filament	NAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030216	keratinocyte differentiation	IEP	biological process
GO:0030280	structural constituent of epidermis	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04915	Estrogen signaling pathway
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Ichthyosis	OMIM: 148080
Epidermolytic hyperkeratosis	OMIM: 148080
Abnormal spermatogenesis	MIK: 21910566
Asthenozoospermia	MIK: 22796355
Male factor infertility	MIK: 22796355
Bullous congenital ichthyosiform erythroderma	KEGG: H00691
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Abnormal spermatogenesis	MIK: 21910566
Asthenozoospermia	MIK: 22796355
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22796355	Asthenozoospermia				Male infertility	66 phosphoproteins
21910566	Abnormal spermatogenesis			30 (10 normal spermatogenesis, 10 maturation arrest, 10 Sertoli cell only syndrome)	Male infertility	CK10
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881