• Gene id: 3845

Gene Summary

• Gene Symbol: KRAS   Gene   UCSC   Ensembl
• Aliases: 'C-K-RAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras, K-Ras 2, KI-RAS, KRAS1, KRAS2, NS, NS3, OES, RALD, RASK2, c-Ki-ras, c-Ki-ras2
• Gene name: KRAS proto-oncogene, GTPase
• Alternate names: GTPase KRas, K-ras p21 protein, Kirsten rat sarcoma viral oncogene homolog, Kirsten rat sarcoma viral proto-oncogene, PR310 c-K-ras oncogene, c-Kirsten-ras protein, cellular c-Ki-ras2 proto-oncogene, cellular transforming proto-oncogene, oncogene KRAS2, transformi,
• Gene location: 12p12.1 (155127875: 155134898)     Exons: 5     NC_000001.11
• Gene summary(Entrez): This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that res
• OMIM: 190070

Protein Summary

• Protein general information: P01116  
  • Name: GTPase KRas (K Ras 2) (Ki Ras) (c K ras) (c Ki ras) [Cleaved into: GTPase KRas, N terminally processed]
  • Length: 189  
  • Mass: 21656
• Sequence:

  MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTG
  EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
  RVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 1D8D 1D8E 1KZO 1KZP 1N4P 1N4Q 1N4R 1N4S 3GFT 4DSN 4DSO 4EPR 4EPT 4EPV 4EPW 4EPX 4EPY 4L8G 4LDJ 4LPK 4LRW 4LUC 4LV6 4LYF 4LYH 4LYJ 4M1O 4M1S 4M1T 4M1W 4M1Y 4M21 4M22 4NMM 4OBE 4PZY 4PZZ 4Q01 4Q02 4Q03 4QL3 4TQ9 4TQA 4WA7 5F2E 5KYK 5MLA 5MLB 5O2S 5O2T 5OCG 5OCO 5OCT 5TAR 5TB5 5UFE 5UFQ 5UK9 5UQW 5US4 5USJ 5V6S 5V6V 5V7
  • PDBsum: 1D8D 1D8E 1KZO 1KZP 1N4P 1N4Q 1N4R 1N4S 3GFT 4DSN 4DSO 4EPR 4EPT 4EPV 4EPW 4EPX 4EPY 4L8G 4LDJ 4LPK 4LRW 4LUC 4LV6 4LYF 4LYH 4LYJ 4M1O 4M1S 4M1T 4M1W 4M1Y 4M21 4M22 4NMM 4OBE 4PZY 4PZZ 4Q01 4Q02 4Q03 4QL3 4TQ9 4TQA 4WA7 5F2E 5KYK 5MLA 5MLB 5O2S 5O2T 5OCG 5OCO 5OCT 5TAR 5TB5 5UFE 5UFQ 5UK9 5UQW 5US4 5USJ 5V6S 5V6V 5V7
  • DIP: 33951
  • STRING: ENSP00000256078
• Other Databases: GeneCards:  KRAS  Malacards:  KRAS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000774	positive regulation of cellular senescence	IEA	biological process
GO:0051385	response to mineralocorticoid	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0043406	positive regulation of MAP kinase activity	IEA	biological process
GO:0030275	LRR domain binding	IEA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019003	GDP binding	IEA	molecular function
GO:0007565	female pregnancy	IEA	biological process
GO:0051146	striated muscle cell differentiation	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0035022	positive regulation of Rac protein signal transduction	IEA	biological process
GO:0032228	regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0051000	positive regulation of nitric-oxide synthase activity	IEA	biological process
GO:0035900	response to isolation stress	IEA	biological process
GO:0019002	GMP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0001889	liver development	IEA	biological process
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0038002	endocrine signaling	IEA	biological process
GO:0021897	forebrain astrocyte development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0008542	visual learning	IEA	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05010	Alzheimer disease
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04010	MAPK signaling pathway
hsa05206	MicroRNAs in cancer
hsa04714	Thermogenesis
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa05034	Alcoholism
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04150	mTOR signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa05226	Gastric cancer
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa05160	Hepatitis C
hsa04210	Apoptosis
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04725	Cholinergic synapse
hsa04068	FoxO signaling pathway
hsa04935	Growth hormone synthesis, secretion and action
hsa04919	Thyroid hormone signaling pathway
hsa04915	Estrogen signaling pathway
hsa04726	Serotonergic synapse
hsa04650	Natural killer cell mediated cytotoxicity
hsa04916	Melanogenesis
hsa05231	Choline metabolism in cancer
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04540	Gap junction
hsa04012	ErbB signaling pathway
hsa04211	Longevity regulating pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa04137	Mitophagy - animal
hsa05210	Colorectal cancer
hsa05220	Chronic myeloid leukemia
hsa05215	Prostate cancer
hsa04720	Long-term potentiation
hsa05214	Glioma
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa04917	Prolactin signaling pathway
hsa05221	Acute myeloid leukemia
hsa05211	Renal cell carcinoma
hsa05218	Melanoma
hsa05223	Non-small cell lung cancer
hsa04929	GnRH secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04730	Long-term depression
hsa04370	VEGF signaling pathway
hsa05213	Endometrial cancer
hsa05230	Central carbon metabolism in cancer
hsa04960	Aldosterone-regulated sodium reabsorption
hsa05216	Thyroid cancer
hsa05219	Bladder cancer

Diseases

Associated diseases	References
Myelodysplastic/myeloproliferative neoplasms	KEGG:H02410
Colorectal cancer	KEGG:H00020
Chronic myelomonocytic leukemia	KEGG:H02411
Noonan syndrome and related disorders	KEGG:H00523
Atypical chronic myeloid leukemia	KEGG:H02412
Thyroid cancer	KEGG:H00032
Gastric cancer	KEGG:H00018
Non-small cell lung cancer	KEGG:H00014
Multiple myeloma	KEGG:H00010
Syndromic craniosynostoses	KEGG:H00458
Noonan syndrome	KEGG:H01738
Acute myeloid leukemia	KEGG:H00003
Cardiofaciocutaneous syndrome	KEGG:H01745
Erdheim-Chester disease	KEGG:H02425
Pancreatic cancer	KEGG:H00019
Oral cancer	KEGG:H00016
Ovarian cancer	KEGG:H00027
Cervical cancer	KEGG:H00030
Squamous cell carcinoma	KEGG:H00040
Gallbladder cancer	KEGG:H00047
Medullary thyroid cancer	KEGG:H01592
Endometrial cancer	KEGG:H00026
Kaposi sarcoma	KEGG:H00041
Cholangiocarcinoma	KEGG:H00046
Hepatic angiosarcoma	KEGG:H01557
Angiosarcoma	KEGG:H01666
Myelodysplastic/myeloproliferative neoplasms	KEGG:H02410
Colorectal cancer	KEGG:H00020
Chronic myelomonocytic leukemia	KEGG:H02411
Noonan syndrome and related disorders	KEGG:H00523
Atypical chronic myeloid leukemia	KEGG:H02412
Thyroid cancer	KEGG:H00032
Gastric cancer	KEGG:H00018
Non-small cell lung cancer	KEGG:H00014
Multiple myeloma	KEGG:H00010
Syndromic craniosynostoses	KEGG:H00458
Noonan syndrome	KEGG:H01738
Acute myeloid leukemia	KEGG:H00003
Cardiofaciocutaneous syndrome	KEGG:H01745
Erdheim-Chester disease	KEGG:H02425
Pancreatic cancer	KEGG:H00019
Oral cancer	KEGG:H00016
Ovarian cancer	KEGG:H00027
Cervical cancer	KEGG:H00030
Squamous cell carcinoma	KEGG:H00040
Gallbladder cancer	KEGG:H00047
Medullary thyroid cancer	KEGG:H01592
Endometrial cancer	KEGG:H00026
Kaposi sarcoma	KEGG:H00041
Cholangiocarcinoma	KEGG:H00046
Hepatic angiosarcoma	KEGG:H01557
Angiosarcoma	KEGG:H01666
Cardiofaciocutaneous syndrome	PMID:16474404
Endometrial hyperplasia	PMID:19419940
Intellectual disability	PMID:17056636
urinary bladder cancer	PMID:1553789
Breast cancer	PMID:19820367
pancreatic cancer	PMID:11115351
Transitional cell carcinoma	PMID:19303097
Glioblastoma multiforme	PMID:19179066
Astrocytoma	PMID:16247081
Malignant glioma	PMID:22207524
grade III astrocytoma	PMID:19179066
Noonan syndrome	PMID:16474405
lung adenocarcinoma	PMID:11745231
seminoma	PMID:8816895
renal cell carcinoma	PMID:11851621
intrahepatic cholangiocarcinoma	PMID:24139215
stomach carcinoma	PMID:7773929
fibrillary astrocytoma	PMID:19179066
hepatocellular carcinoma	PMID:29275358
Pancreatic mucinous cystadenoma	PMID:28570009
myeloid sarcoma	PMID:23564351
acute myeloid leukemia	PMID:8955068
acute myeloid leukemia	PMID:21283084
colorectal cancer	PMID:22971512
multiple myeloma	PMID:16321859
acute lymphocytic leukemia	PMID:25917266
acute lymphocytic leukemia	PMID:17910045
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)