• Gene id: 3843

Gene Summary

• Gene Symbol: IPO5   Gene   UCSC   Ensembl
• Aliases: IMB3, KPNB3, Pse1, RANBP5, imp5
• Gene name: importin 5
• Alternate names: importin-5, RAN binding protein 5, Ran_GTP binding protein 5, importin beta-3 subunit, importin subunit beta-3, karyopherin (importin) beta 3, karyopherin beta-3, ran-binding protein 5,
• Gene location: 13q32.2 (97953640: 98024295)     Exons: 31     NC_000013.11
• Gene summary(Entrez): Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a het
• OMIM: 602008

Protein Summary

• Protein general information: O00410  
  • Name: Importin 5 (Imp5) (Importin subunit beta 3) (Karyopherin beta 3) (Ran binding protein 5) (RanBP5)
  • Length: 1097  
  • Mass: 123630
• Sequence:

  MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLLSSAFD
  EVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNVGLREA
  ALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAV
  NDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTSLNNMQRQLALEVIVTLSETAAAMLRKHTNI
  VAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYR
  HAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDFAPGFQKKFHEKVIAALLQTM
  EDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDNLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEE
  KFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFNDMEDDDPQ
  ISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGL
  EEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDGVRVAAAESMPLLLECARVRGPEYLTQMWHFMC
  DALIKAIGTEPDSDVLSEIMHSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVE
  ESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASF
  KYAEYFLRPMLQYVCDNSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADSKTKENVNATENCISA
  VGKIMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEA
  IKHEDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA

• Structural information:
  • Protein Domains: (28..9-)
    (/note="Importin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00115"-)
  • Interpro: IPR016024  IPR000357  IPR001494  IPR040122  IPR041653   IPR041389  IPR034085  
  • Prosite: PS50166
  • DIP: 41042
  • STRING: ENSP00000261574
• Other Databases: GeneCards:  IPO5  Malacards:  IPO5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0006606	protein import into nucleus	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0042307	positive regulation of protein import into nucleus	ISS	biological process
GO:0006607	NLS-bearing protein import into nucleus	ISS	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005643	nuclear pore	TAS	cellular component
GO:0006607	NLS-bearing protein import into nucleus	TAS	biological process
GO:0005095	GTPase inhibitor activity	TAS	molecular function
GO:0008536	Ran GTPase binding	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006607	NLS-bearing protein import into nucleus	IEA	biological process
GO:0042307	positive regulation of protein import into nucleus	IEA	biological process
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0061608	nuclear import signal receptor activity	ISS	molecular function
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0006610	ribosomal protein import into nucleus	IDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R