• Gene id: 3840

Gene Summary

• Gene Symbol: KPNA4   Gene   UCSC   Ensembl
• Aliases: IPOA3, QIP1, SRP3
• Gene name: karyopherin subunit alpha 4
• Alternate names: importin subunit alpha-3, importin alpha Q1, importin subunit alpha-4, karyopherin alpha 4 (importin alpha 3),
• Gene location: 3q25.33 (160565570: 160495006)     Exons: 17     NC_000003.12
• Gene summary(Entrez): The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognize NLSs and dock NLS-containing proteins to the nuclear pore
• OMIM: 602970

Protein Summary

• Protein general information: O00629  
  • Name: Importin subunit alpha 3 (Importin alpha Q1) (Qip1) (Karyopherin subunit alpha 4)
  • Length: 521  
  • Mass: 57887
  • Tissue specificity: Highly expressed in testis, ovary, small intestine, heart, skeletal muscle, lung and pancreas, but barely detectable in kidney, thymus, colon and peripheral blood leukocytes.
• Sequence:

  MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEA
  IVQNASSDNQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQT
  QAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVMV
  NLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVIDSGIVPHLVPLLSHQEVKV
  QTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIH
  LLDKGDFGTQKEAAWAISNLTISGRKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDEAETIG
  NLIEECGGLEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPEAIQGGTFGFNSSANVPTEGFQF

• Structural information:
  • Protein Domains: (2..5-)
    (/note="IBB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00561"-)
  • Interpro: IPR011989  IPR016024  IPR032413  IPR000225  IPR002652   IPR036975  IPR024931  
  • Prosite: PS50176 PS51214
  • PDB: 4UAE 5TBK 5XZX 6BVV 6BVZ 6BW9 6BWA 6BWB
  • PDBsum: 4UAE 5TBK 5XZX 6BVV 6BVZ 6BW9 6BWA 6BWB
  • DIP: 32982
  • STRING: ENSP00000334373
• Other Databases: GeneCards:  KPNA4  Malacards:  KPNA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0006607	NLS-bearing protein import into nucleus	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0042025	host cell nucleus	IEA	cellular component
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006607	NLS-bearing protein import into nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019054	modulation by virus of host cellular process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq