• Gene id: 384

Gene Summary

• Gene Symbol: ARG2   Gene   UCSC   Ensembl
• Gene name: arginase 2
• Alternate names: arginase-2, mitochondrial, L-arginine amidinohydrolase, L-arginine ureahydrolase, arginase II, arginase, type II, kidney arginase, kidney-type arginase, non-hepatic arginase, nonhepatic arginase, type II arginase,
• Gene location: 14q24.1 (67619861: 67651719)     Exons: 8     NC_000014.9
• Gene summary(Entrez): Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic fun
• OMIM: 107830

SNPs

rs35397110

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000023.11   g.133027131G>A
NC_000023.11   g.133027131G>T
NC_000023.10   g.132161159G>A
NC_000023.10   g.132161159G>T
NG_013268.1   g.6142C>T
NG_013268.1   g.6142C>A
NM_031907.2   c.1090C>T
NM_031907.2   c.1090C>A
NM_031907.1   c.1090C>T
NM_031907.1   c.1090C>A
XM_017  

Protein Summary

• Protein general information: P78540  
  • Name: Arginase 2, mitochondrial (EC 3.5.3.1) (Arginase II) (Kidney type arginase) (Non hepatic arginase) (Type II arginase)
  • Length: 354  
  • Mass: 38,578
• Sequence:

  MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTP
  VPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINT
  PLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRL
  GIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
  LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI

• Structural information:
  • Interpro: IPR014033  IPR006035  IPR023696  IPR020855  
  • Prosite: PS01053 PS51409
  • PDB: 1PQ3 4HZE 4I06 4IE2 4IE3 4IXU 4IXV
  • PDBsum: 1PQ3 4HZE 4I06 4IE2 4IE3 4IXU 4IXV
  • STRING: ENSP00000261783
• Other Databases: GeneCards:  ARG2  Malacards:  ARG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000050	urea cycle	IEA	biological process
GO:0000050	urea cycle	TAS	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0004053	arginase activity	EXP	molecular function
GO:0004053	arginase activity	IMP	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006525	arginine metabolic process	IEA	biological process
GO:0006809	nitric oxide biosynthetic process	TAS	biological process
GO:0006941	striated muscle contraction	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0000050	urea cycle	IEA	biological process
GO:0000050	urea cycle	IEA	biological process
GO:0000050	urea cycle	TAS	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0004053	arginase activity	IEA	molecular function
GO:0004053	arginase activity	IEA	molecular function
GO:0004053	arginase activity	EXP	molecular function
GO:0004053	arginase activity	IMP	molecular function
GO:0004053	arginase activity	TAS	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006525	arginine metabolic process	IEA	biological process
GO:0006525	arginine metabolic process	IEA	biological process
GO:0006809	nitric oxide biosynthetic process	TAS	biological process
GO:0006941	striated muscle contraction	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016813	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000050	urea cycle	TAS	biological process
GO:0004053	arginase activity	EXP	molecular function
GO:0004053	arginase activity	IMP	molecular function
GO:0004053	arginase activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006809	nitric oxide biosynthetic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01230	Biosynthesis of amino acids
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Cancer	GAD: 19789190
Cancer (lung)	GAD: 19789190
Asthma	GAD: 16387594
Female infertility	INFBASE: 26148093
Male factor infertility	MIK: 25890347
Varicocele	MIK: 25890347
Endometriosis	INFBASE: 26148093
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Varicocele	MIK: 25890347

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25890347	Varicocele			10 (5 unilateral varicocele, 5 fertile men)	Male infertility	CRISP2 ARG2
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881