• Gene id: 3839

Gene Summary

• Gene Symbol: KPNA3   Gene   UCSC   Ensembl
• Aliases: IPOA4, SRP1, SRP1gamma, SRP4, hSRP1
• Gene name: karyopherin subunit alpha 3
• Alternate names: importin subunit alpha-4, SRP1-gamma, importin alpha 4, importin alpha Q2, importin alpha-3, importin subunit alpha-3, karyopherin alpha 3 (importin alpha 4), qip2,
• Gene location: 13q14.2 (49792681: 49699306)     Exons: 18     NC_000013.11
• Gene summary(Entrez): The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusio
• OMIM: 601892

Protein Summary

• Protein general information: O00505  
  • Name: Importin subunit alpha 4 (Importin alpha Q2) (Qip2) (Karyopherin subunit alpha 3) (SRP1 gamma)
  • Length: 521  
  • Mass: 57811
  • Tissue specificity: Ubiquitous. Highest levels in heart and skeletal muscle.
• Sequence:

  MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEA
  ILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQT
  QAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTWVIV
  NLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYLTDGGNEQIQMVIDSGVVPFLVPLLSHQEVKV
  QTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNLLSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIH
  QLAKGDFGTQKEAAWAISNLTISGRKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIA
  EIIEECGGLEKIEVLQQHENEDIYKLAFEIIDQYFSGDDIDEDPCLIPEATQGGTYNFDPTANLQTKEFNF

• Structural information:
  • Protein Domains: (2..5-)
    (/note="IBB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00561"-)
  • Interpro: IPR011989  IPR016024  IPR032413  IPR000225  IPR002652   IPR036975  IPR024931  
  • Prosite: PS50176 PS51214
  • DIP: 27586
  • STRING: ENSP00000261667
• Other Databases: GeneCards:  KPNA3  Malacards:  KPNA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0006607	NLS-bearing protein import into nucleus	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0046718	viral entry into host cell	IEA	biological process
GO:0075732	viral penetration into host nucleus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0008139	nuclear localization sequence binding	TAS	molecular function
GO:0005643	nuclear pore	TAS	cellular component
GO:0006607	NLS-bearing protein import into nucleus	TAS	biological process
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019054	modulation by virus of host cellular process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray