• Gene id: 3836

Gene Summary

• Gene Symbol: KPNA1   Gene   UCSC   Ensembl
• Aliases: IPOA5, NPI-1, RCH2, SRP1
• Gene name: karyopherin subunit alpha 1
• Alternate names: importin subunit alpha-5, RAG cohort protein 2, SRP1-beta, importin alpha 5, importin subunit alpha-1, importin-alpha-S1, karyopherin alpha 1 (importin alpha 5), nucleoprotein interactor 1, recombination activating gene cohort 2,
• Gene location: 3q21.1 (122514938: 122421901)     Exons: 17     NC_000003.12
• Gene summary(Entrez): The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusio
• OMIM: 600686

Protein Summary

• Protein general information: P52294  
  • Name: Importin subunit alpha 5 (Karyopherin subunit alpha 1) (Nucleoprotein interactor 1) (NPI 1) (RAG cohort protein 2) (SRP1 beta) [Cleaved into: Importin subunit alpha 5, N terminally processed]
  • Length: 538  
  • Mass: 60222
  • Tissue specificity: Expressed ubiquitously.
• Sequence:

  MTTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNM
  EMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWV
  LTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNR
  LTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR
  LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQT
  VIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENI
  LRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYI
  FQQCEAPMEGFQL

• Structural information:
  • Protein Domains: (1..5-)
    (/note="IBB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00561"-)
  • Interpro: IPR011989  IPR016024  IPR032413  IPR000225  IPR002652   IPR036975  IPR024931  
  • Prosite: PS50176 PS51214
  • PDB: 2JDQ 3TJ3 4B18
  • PDBsum: 2JDQ 3TJ3 4B18
  • DIP: 29296
  • STRING: ENSP00000343701
• Other Databases: GeneCards:  KPNA1  Malacards:  KPNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0099527	postsynapse to nucleus signaling pathway	IBA	biological process
GO:0061608	nuclear import signal receptor activity	IBA	molecular function
GO:0008139	nuclear localization sequence binding	IBA	molecular function
GO:0006607	NLS-bearing protein import into nucleus	IBA	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0061608	nuclear import signal receptor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008139	nuclear localization sequence binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0000018	regulation of DNA recombination	TAS	biological process
GO:0005643	nuclear pore	TAS	cellular component
GO:0006607	NLS-bearing protein import into nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006309	apoptotic DNA fragmentation	TAS	biological process
GO:0019054	modulation by virus of host cellular process	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0099527	postsynapse to nucleus signaling pathway	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05164	Influenza A

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)