• Gene id: 3835

Gene Summary

• Gene Symbol: KIF22   Gene   UCSC   Ensembl
• Aliases: A-328A3.2, KID, KNSL4, OBP, OBP-1, OBP-2, SEMDJL2
• Gene name: kinesin family member 22
• Alternate names: kinesin-like protein KIF22, kinesin-like DNA-binding protein pseudogene, kinesin-like protein 4, oriP binding protein, origin of plasmid DNA replication-binding protein,
• Gene location: 16p11.2 (29790733: 29805542)     Exons: 16     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. The C-terminal half of this pr
• OMIM: 618519

Protein Summary

• Protein general information: Q14807  
  • Name: Kinesin like protein KIF22 (Kinesin like DNA binding protein) (Kinesin like protein 4)
  • Length: 665  
  • Mass: 73262
  • Tissue specificity: Expressed in bone, cartilage, joint capsule, ligament, skin, and primary cultured chondrocytes. {ECO
• Sequence:

  MAAGGSTQQRRREMAAASAAAISGAGRCRLSKIGATRRPPPARVRVAVRLRPFVDGTAGASDPPCVRGMDSCSLE
  IANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRA
  LMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLSQKPISSFADFERHF
  LPASRNRTVGATRLNQRSSRSHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTS
  LFVLGKVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVSALNFAARSKEVINRPFTN
  ESLQPHALGPVKLSQKELLGPPEAKRARGPEEEEIGSPEPMAAPASASQKLSPLQKLSSMDPAMLERLLSLDRLL
  ASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQKAEEKENHCPTMLRPLSHRTVTGAKP
  LKKAVVMPLQLIQEQAASPNAEIHILKNKGRKRKLESLDALEPEEKAEDCWELQISPELLAHGRQKILDLLNEGS
  ARDLRSLQRIGPKKAQLIVGWRELHGPFSQVEDLERVEGITGKQMESFLKANILGLAAGQRCGAS

• Structural information:
  • Protein Domains: (43..36-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR003583  IPR026986  IPR027640  IPR019821  IPR001752   IPR036961  IPR027417  IPR010994  
  • Prosite: PS00411 PS50067
  • PDB: 2EDU 6NJE
  • PDBsum: 2EDU 6NJE
  • STRING: ENSP00000160827
• Other Databases: GeneCards:  KIF22  Malacards:  KIF22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005874	microtubule	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0072686	mitotic spindle	IDA	cellular component
GO:0007062	sister chromatid cohesion	IMP	biological process
GO:0007080	mitotic metaphase plate congression	IMP	biological process
GO:0051310	metaphase plate congression	IMP	biological process
GO:0051310	metaphase plate congression	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	TAS	molecular function
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0000776	kinetochore	TAS	cellular component
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007018	microtubule-based movement	TAS	biological process
GO:0005819	spindle	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
SEMD with joint laxity type	KEGG:H01494
SEMD with joint laxity type	KEGG:H01494
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R