• Gene id: 3834

Gene Summary

• Gene Symbol: KIF25   Gene   UCSC   Ensembl
• Aliases: KNSL3
• Gene name: kinesin family member 25
• Alternate names: kinesin-like protein KIF25, kinesin-like 3, kinesin-like protein 3,
• Gene location: 6q27 (167999091: 168045106)     Exons: 12     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular fu
• OMIM: 600194

Protein Summary

• Protein general information: Q9UIL4  
  • Name: Kinesin like protein KIF25 (Kinesin like protein 3)
  • Length: 384  
  • Mass: 40686
• Sequence:

  MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLTSLLDGYNVCVMAYGQTGSGKSYTM
  LGRHSDDGPVLPLDPQSDLGIIPRVAEELFRLILENTSRSPKVEVSIVEVYNNDIFDLLAKDSIAAVSGVKREVV
  TAKDGRTEVALLASEAVGSASKLMELVHGGLQLRAKHPTLVHADSSRSHLIITVTLTTASCSDSTADQACSATLP
  REQTEAGRAGRSRRASQGALAPQLVPGNPAGHAEQVQARLQLVDSAGSECVGVSGVTGLALREMACISRSLAALA
  GVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIRARQVQRGPARKKPPSS
  QTEGKRRPD

• Structural information:
  • Protein Domains: (7..36-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • STRING: ENSP00000388878
• Other Databases: GeneCards:  KIF25  Malacards:  KIF25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0005874	microtubule	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0051647	nucleus localization	IDA	biological process
GO:0051294	establishment of spindle orientation	IDA	biological process
GO:0046603	negative regulation of mitotic centrosome separation	IDA	biological process
GO:0005813	centrosome	ISS	cellular component
GO:0051289	protein homotetramerization	ISS	biological process
GO:0008569	ATP-dependent microtubule motor activity, minus-end-directed	ISS	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000070	mitotic sister chromatid segregation	TAS	biological process
GO:0006996	organelle organization	TAS	biological process
GO:0005871	kinesin complex	TAS	cellular component
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray