Search Result
Gene id | 3823 | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
Gene Symbol | KLRC3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
Aliases | NKG2-E, NKG2E | ||||||||||||||||||||||||||||
Gene name | killer cell lectin like receptor C3 | ||||||||||||||||||||||||||||
Alternate names | NKG2-E type II integral membrane protein, NK cell receptor E, NKG2-E-activating NK receptor, killer cell lectin-like receptor subfamily C, member 3, | ||||||||||||||||||||||||||||
Gene location |
12p13.2 (10420594: 10412314) Exons: 7 NC_000012.12 |
||||||||||||||||||||||||||||
Gene summary(Entrez) |
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci |
||||||||||||||||||||||||||||
OMIM | 602892 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
Protein general information | Q07444 Name: NKG2 E type II integral membrane protein (NK cell receptor E) (NKG2 E activating NK receptor) Length: 240 Mass: 27100 Tissue specificity: Natural killer cells. | ||||||||||||||||||||||||||||
Sequence |
MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYDCQGLLPPPEKLTAEV LGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLQACASKNS SSLLCIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRI IRRGFIMLTRLVLNS | ||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||
Other Databases | GeneCards: KLRC3 Malacards: KLRC3 | ||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
KEGG pathways
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||
|