• Gene id: 3822

Gene Summary

• Gene Symbol: KLRC2   Gene   UCSC   Ensembl
• Aliases: CD159c, NKG2-C, NKG2C
• Gene name: killer cell lectin like receptor C2
• Alternate names: NKG2-C type II integral membrane protein, CD159 antigen-like family member C, NK cell receptor C, NKG2-C-activating NK receptor, killer cell lectin-like receptor subfamily C, member 2,
• Gene location: 12p13.2 (10435992: 10430598)     Exons: 6     NC_000012.12
• Gene summary(Entrez): Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
• OMIM: 602891

Protein Summary

• Protein general information: P26717  
  • Name: NKG2 C type II integral membrane protein (CD159 antigen like family member C) (NK cell receptor C) (NKG2 C activating NK receptor) (CD antigen CD159c)
  • Length: 231  
  • Mass: 26072
  • Tissue specificity: Natural killer cells.
• Sequence:

  MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEKLTAEV
  LGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNS
  SLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIY
  HCKHKL

• Structural information:
  • Protein Domains: (116..22-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR016187  IPR033992  
  • Prosite: PS50041
  • CDD: cd03593
  • PDB: 2L35
  • PDBsum: 2L35
  • STRING: ENSP00000371327
• Other Databases: GeneCards:  KLRC2  Malacards:  KLRC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006968	cellular defense response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045087	innate immune response	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:1990405	protein antigen binding	IDA	molecular function
GO:0043235	receptor complex	IDA	cellular component
GO:0002228	natural killer cell mediated immunity	IDA	biological process
GO:0023024	MHC class I protein complex binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04650	Natural killer cell mediated cytotoxicity
hsa04612	Antigen processing and presentation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)