• Gene id: 382

Gene Summary

• Gene Symbol: ARF6   Gene   UCSC   Ensembl
• Gene name: ADP ribosylation factor 6
• Alternate names: ADP-ribosylation factor 6,
• Gene location: 14q21.3 (49893081: 49897053)     Exons: 2     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular

Protein Summary

• Protein general information: P62330  
  • Name: ADP ribosylation factor 6
  • Length: 175  
  • Mass: 20082
  • Tissue specificity: Ubiquitous, with higher levels in heart, substantia nigra, and kidney. {ECO
• Sequence:

  MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWR
  HYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWY
  VQPSCATSGDGLYEGLTWLTSNYKS

• Structural information:
  • Interpro: IPR041838  IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • CDD: cd04149
  • PDB: 1E0S 2A5D 2A5F 2A5G 2BAO 2BAU 2J5X 2W83 3LVQ 3LVR 3N5C 3PCR 4FME 4KAX 6BBP 6BBQ
  • PDBsum: 1E0S 2A5D 2A5F 2A5G 2BAO 2BAU 2J5X 2W83 3LVQ 3LVR 3N5C 3PCR 4FME 4KAX 6BBP 6BBQ
  • DIP: 33352
  • STRING: ENSP00000298316
• Other Databases: GeneCards:  ARF6  Malacards:  ARF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0120183	positive regulation of focal adhesion disassembly	ISS	biological process
GO:0051549	positive regulation of keratinocyte migration	ISS	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030139	endocytic vesicle	IBA	cellular component
GO:0036010	protein localization to endosome	IBA	biological process
GO:0001726	ruffle	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0005768	endosome	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0060998	regulation of dendritic spine development	IBA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0051489	regulation of filopodium assembly	IDA	biological process
GO:0031527	filopodium membrane	IDA	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0090543	Flemming body	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0060998	regulation of dendritic spine development	ISS	biological process
GO:0036010	protein localization to endosome	IMP	biological process
GO:0031996	thioesterase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097284	hepatocyte apoptotic process	IEA	biological process
GO:0090162	establishment of epithelial cell polarity	IEA	biological process
GO:0060998	regulation of dendritic spine development	IEA	biological process
GO:0033028	myeloid cell apoptotic process	IEA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:2000171	negative regulation of dendrite development	IEA	biological process
GO:1990090	cellular response to nerve growth factor stimulus	IEA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0060998	regulation of dendritic spine development	IEA	biological process
GO:0055037	recycling endosome	IEA	cellular component
GO:0032456	endocytic recycling	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:2000009	negative regulation of protein localization to cell surface	IEA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:0120183	positive regulation of focal adhesion disassembly	IEA	biological process
GO:0051549	positive regulation of keratinocyte migration	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0036010	protein localization to endosome	IEA	biological process
GO:0034394	protein localization to cell surface	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001889	liver development	IEA	biological process
GO:0099562	maintenance of postsynaptic density structure	IEA	biological process
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0034394	protein localization to cell surface	ISS	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	ISS	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0031527	filopodium membrane	IEA	cellular component
GO:0090543	Flemming body	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0032456	endocytic recycling	IDA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0097178	ruffle assembly	IDA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0030866	cortical actin cytoskeleton organization	IDA	biological process
GO:0035020	regulation of Rac protein signal transduction	IDA	biological process
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0048261	negative regulation of receptor-mediated endocytosis	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0030866	cortical actin cytoskeleton organization	IMP	biological process
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0005768	endosome	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030838	positive regulation of actin filament polymerization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0050714	positive regulation of protein secretion	IMP	biological process
GO:0005525	GTP binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04072	Phospholipase D signaling pathway
hsa05135	Yersinia infection
hsa04666	Fc gamma R-mediated phagocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881