• Gene id: 3817

Gene Summary

• Gene Symbol: KLK2   Gene   UCSC   Ensembl
• Aliases: KLK2A2, hGK-1, hK2
• Gene name: kallikrein related peptidase 2
• Alternate names: kallikrein-2, glandular kallikrein 2, glandular kallikrein-1, kallikrein 2, prostatic, tissue kallikrein-2,
• Gene location: 19q13.33 (50873432: 50880566)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the grandular kallikrein protein family. Kallikreins are a subgroup of serine proteases that are clustered on chromosome 19. Members of this family are involved in a diverse array of biological functions. The protein encoded
• OMIM: 147960

SNPs

rs2664155

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000019.10   g.50873774G>A
NC_000019.9   g.51377030G>A
NG_031984.1   g.5342G>A|SEQ=[G/A]|GENE=KLK2

Protein Summary

• Protein general information: P20151  
  • Name: Kallikrein 2 (EC 3.4.21.35) (Glandular kallikrein 1) (hGK 1) (Tissue kallikrein 2)
  • Length: 261  
  • Mass: 28671
• Sequence:

  MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWL
  GRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGT
  TCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQG
  ITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

• Structural information:
  • Protein Domains: (25..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 4NFE 4NFF
  • PDBsum: 4NFE 4NFF
  • STRING: ENSP00000313581
• Other Databases: GeneCards:  KLK2  Malacards:  KLK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0031638	zymogen activation	IBA	biological process
GO:0003073	regulation of systemic arterial blood pressure	IBA	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa04614	Renin-angiotensin system

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq