• Gene id: 3814

Gene Summary

• Gene Symbol: KISS1   Gene   UCSC   Ensembl
• Aliases: HH13, KiSS-1
• Gene name: KiSS-1 metastasis suppressor
• Alternate names: metastasis-suppressor KiSS-1, kisspeptin-1, malignant melanoma metastasis-suppressor, metastin, prepro-kisspeptin,
• Gene location: 1q32.1 (204196490: 204190340)     Exons: 3     NC_000001.11
• Gene summary(Entrez): This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Stud
• OMIM: 603286

Protein Summary

• Protein general information: Q15726  
  • Name: Metastasis suppressor KiSS 1 (Kisspeptin 1) [Cleaved into: Metastin (Kisspeptin 54); Kisspeptin 14; Kisspeptin 13; Kisspeptin 10]
  • Length: 138  
  • Mass: 14,705
• Sequence:

  MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTSLSPPP
  ESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG

• Structural information:
  • Interpro: IPR020207  
  • STRING: ENSP00000356162
• Other Databases: GeneCards:  KISS1  Malacards:  KISS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007010	cytoskeleton organization	TAS	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0031773	kisspeptin receptor binding	IEA	molecular function
GO:0033686	positive regulation of luteinizing hormone secretion	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway	IEA	biological process
GO:0060112	generation of ovulation cycle rhythm	IEA	biological process
GO:0060124	positive regulation of growth hormone secretion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007010	cytoskeleton organization	TAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0031773	kisspeptin receptor binding	IEA	molecular function
GO:0033686	positive regulation of luteinizing hormone secretion	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway	IEA	biological process
GO:0060112	generation of ovulation cycle rhythm	IEA	biological process
GO:0060124	positive regulation of growth hormone secretion	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007010	cytoskeleton organization	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Cancer	GAD: 19895172
Cancer (breast)	GAD: 19895172
Hypertension	GAD: 19536175
Hypertension	GAD: 19536175
Kallmann syndrome (KS)	GAD: 18682503
Precocious puberty	GAD: 17609410
Precocious puberty	GAD: 20631455
Polycystic ovary syndrome (PCOS)	INFBASE: 20078960
Polycystic ovary syndrome (PCOS)	INFBASE: 23571154
Oligoasthenoteratozoospermia	MIK: 25556380
Oligoasthenozoospermia	MIK: 25556380
Male factor infertility	MIK: 25556380
Asthenozoospermia	MIK: 25556380
Asthenoteratozoospermia	MIK: 25556380
Azoospermia	MIK: 25556380
Oligozoospermia	MIK: 25556380
Hypogonadotropic hypogonadism	OMIM: 603286, KEGG: H00255
Male infertility	MIK: 31332817
Asthenozoospermia	MIK: 25556380
Asthenoteratozoospermia	MIK: 25556380
Azoospermia	MIK: 25556380
Oligozoospermia	MIK: 25556380
Oligoasthenozoospermia	MIK: 25556380
Oligoasthenoteratozoospermia	MIK: 25556380

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25556380	Male infertility, asthenozoospermia, asthenoteratozoospermia, azoospermia, oligozoospermia, oligoasthenozoospermia, oligoasthenoteratozoospermia			176 (26 fertile and 150 infertile (22 asthenozoospermia, 08 asthenoteratozoospermia, 18 azoospermia, 58 normozoospermia, 06 oligozoospermia, 12 oligoasthenozoospermia and 26 oligoasthenoteratozoospermia))	Male infertility
30729125	Male fertility, male reproductive health		Chinese	666
31332817	Male infertility	(E1225K [G/A 3673], (P1945A [C/G 5833]; Insertion of T at 6075; G2026G [C/G 6078])		168 (88 cases, 80 controls)	Male infertility