About Us

Search Result


Gene id 3803
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol KIR2DL2   Gene   UCSC   Ensembl
Aliases CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Gene name killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
Alternate names killer cell immunoglobulin-like receptor 2DL2, CD158 antigen-like family member B1, MHC class I NK cell receptor, killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 2, natural killer-associated transcript 6, p58 NK receptor CL-4,
Gene location 19q13.4 (: )     Exons:     
Gene summary(Entrez) Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the
OMIM 604937

Protein Summary

Protein general information P43627  

Name: Killer cell immunoglobulin like receptor 2DL2 (CD158 antigen like family member B1) (MHC class I NK cell receptor) (Natural killer associated transcript 6) (NKAT 6) (p58 natural killer cell receptor clone CL 43) (p58 NK receptor CL 43) (CD antigen CD158b1

Length: 348  Mass: 38,472

Sequence MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGE
HHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCS
SRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPS
NSWPSPTEPSSKTGNPRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYAELPNAESRSKVVSCP
Structural information
Protein Domains
Ig-like (42-107)
Ig-like (142-205)
Interpro:  IPR036179  IPR013783  IPR003599  IPR013151  

PDB:  
1EFX 2DL2 2DLI
PDBsum:   1EFX 2DL2 2DLI
Other Databases GeneCards:  KIR2DL2  Malacards:  KIR2DL2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005886 plasma membrane
TAS cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0050776 regulation of immune resp
onse
TAS biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0050776 regulation of immune resp
onse
TAS biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0050776 regulation of immune resp
onse
TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa00270Cysteine and methionine metabolism
hsa00513Various types of N-glycan biosynthesis
hsa00604Glycosphingolipid biosynthesis - ganglio series
hsa04010MAPK signaling pathway
hsa04218Cellular senescence
hsa04650Natural killer cell mediated cytotoxicity
hsa04612Antigen processing and presentation
hsa05332Graft-versus-host disease
Associated diseases References
Cancer (Hepatocellular) GAD: 19326408
Cancer (leukemia) GAD: 19450876
Cancer (lymphoma) GAD: 20207982
Cancer (melanoma) GAD: 15248031
Cancer (Neuroblastoma) GAD: 19934297
Cancer GAD: 19934297
Cancer (cervical) GAD: 15730517
Angina pectoris GAD: 18755860
Graves disease GAD: 19664392
Autoimmune diseases GAD: 20082482
Axial spondyloarthropathy GAD: 19850842
Behcet's disease GAD: 17868255
Celiac disease GAD: 12121272
Crohn's disease GAD: 19789864
Sjogren's syndrome GAD: 19181658
Ulcerative colitis GAD: 16929347
Multiple sclerosis GAD: 19421224
Scleroderma GAD: 20082621
Psoriasis GAD: 15140215
Psoriatic arthritis GAD: 16112031
Systemic lupus erythematosus (SLE) GAD: 19926642
Diabetes GAD: 15699512
Osteoarthritis GAD: 19489269
Ankylosing spondylitis GAD: 19019897
Paraparesis GAD: 20483367
Vogt-Koyanagi-Harada syndrome GAD: 19897003
Uveomeningoencephalitic syndrome GAD: 18571006
Pregnancy loss GAD: 19279038
Spontaneous abortion GAD: 19875891
Recurrent pregnancy loss (RPL) INFBASE: 17445181
Cryptorchidism MIK: 26679162
Cryptorchidism MIK: 26679162
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
26679162 Cryptorchi
dism

245 (109 prepub
ertal boys with
cryptorchidism
, 136 ethnicall
y matched young
male donors)
Male infertility
Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract