• Gene id: 3799

Gene Summary

• Gene Symbol: KIF5B   Gene   UCSC   Ensembl
• Aliases: HEL-S-61, KINH, KNS, KNS1, UKHC
• Gene name: kinesin family member 5B
• Alternate names: kinesin-1 heavy chain, conventional kinesin heavy chain, epididymis secretory protein Li 61, kinesin 1 (110-120kD), kinesin heavy chain, ubiquitous kinesin heavy chain,
• Gene location: 10p11.22 (32056424: 32009014)     Exons: 27     NC_000010.11
• OMIM: 602809

Protein Summary

• Protein general information: P33176  
  • Name: Kinesin 1 heavy chain (Conventional kinesin heavy chain) (Ubiquitous kinesin heavy chain) (UKHC)
  • Length: 963  
  • Mass: 109685
• Sequence:

  MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLE
  GYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSK
  TNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSG
  KLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
  CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKILRNTIQWLENELNRWRNGETVP
  IDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLK
  TQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQ
  KSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
  VKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDALSEELVQLR
  AQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLEQERLRVE
  HEKLKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGS
  AAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
  RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGGKQV

• Structural information:
  • Protein Domains: (8..32-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • PDB: 1BG2 1MKJ 2P4N 3J8X 3J8Y 4HNA 4LNU 5LT0 5LT1 5LT2 5LT3 5LT4
  • PDBsum: 1BG2 1MKJ 2P4N 3J8X 3J8Y 4HNA 4LNU 5LT0 5LT1 5LT2 5LT3 5LT4
  • DIP: 29244
  • STRING: ENSP00000307078
• Other Databases: GeneCards:  KIF5B  Malacards:  KIF5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003777	microtubule motor activity	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0047496	vesicle transport along microtubule	IDA	biological process
GO:1990048	anterograde neuronal dense core vesicle transport	ISS	biological process
GO:1990049	retrograde neuronal dense core vesicle transport	ISS	biological process
GO:1990049	retrograde neuronal dense core vesicle transport	ISS	biological process
GO:0008017	microtubule binding	ISS	molecular function
GO:0003777	microtubule motor activity	ISS	molecular function
GO:0047496	vesicle transport along microtubule	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0005874	microtubule	IBA	cellular component
GO:0007411	axon guidance	IBA	biological process
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0048489	synaptic vesicle transport	IBA	biological process
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0030705	cytoskeleton-dependent intracellular transport	IBA	biological process
GO:0098971	anterograde dendritic transport of neurotransmitter receptor complex	IBA	biological process
GO:0099641	anterograde axonal protein transport	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051642	centrosome localization	IMP	biological process
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0005871	kinesin complex	TAS	cellular component
GO:0007018	microtubule-based movement	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072383	plus-end-directed vesicle transport along microtubule	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0047496	vesicle transport along microtubule	IEA	biological process
GO:0043227	membrane-bounded organelle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0035253	ciliary rootlet	IEA	cellular component
GO:1905152	positive regulation of voltage-gated sodium channel activity	IEA	biological process
GO:0099641	anterograde axonal protein transport	IEA	biological process
GO:0090316	positive regulation of intracellular protein transport	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0047496	vesicle transport along microtubule	IEA	biological process
GO:0044295	axonal growth cone	IEA	cellular component
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0035617	stress granule disassembly	IEA	biological process
GO:0032230	positive regulation of synaptic transmission, GABAergic	IEA	biological process
GO:0030139	endocytic vesicle	IEA	cellular component
GO:0007028	cytoplasm organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:1990049	retrograde neuronal dense core vesicle transport	IEA	biological process
GO:0099609	microtubule lateral binding	IEA	molecular function
GO:0031340	positive regulation of vesicle fusion	IEA	biological process
GO:0008432	JUN kinase binding	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0042391	regulation of membrane potential	IDA	biological process
GO:0043268	positive regulation of potassium ion transport	IDA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IDA	biological process
GO:0035617	stress granule disassembly	ISS	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa04144	Endocytosis
hsa05012	Parkinson disease
hsa04728	Dopaminergic synapse

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray