• Gene id: 3791

Gene Summary

• Gene Symbol: KDR   Gene   UCSC   Ensembl
• Aliases: CD309, FLK1, VEGFR, VEGFR2
• Gene name: kinase insert domain receptor
• Alternate names: vascular endothelial growth factor receptor 2, fetal liver kinase-1, kinase insert domain receptor (a type III receptor tyrosine kinase), protein-tyrosine kinase receptor Flk-1, soluble VEGFR2, tyrosine kinase growth factor receptor,
• Gene location: 4q12 (55125594: 55078480)     Exons: 30     NC_000004.12
• Gene summary(Entrez): Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions a
• OMIM: 191306

Protein Summary

• Protein general information: P35968  
  • Name: Vascular endothelial growth factor receptor 2 (VEGFR 2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK 1) (Kinase insert domain receptor) (KDR) (Protein tyrosine kinase receptor flk 1) (CD antigen CD309)
  • Length: 1356  
  • Mass: 151,527
• Sequence:

  MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVE
  VTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPC
  LGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYD
  VVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
  DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNH
  TIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAI
  PPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVS
  ALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
  PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLEN
  QTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEA
  FFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDAS
  KWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
  LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASS
  GFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLA
  RDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRM
  RAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
  CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDR
  TKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTT
  LSSPPV

• Structural information:
  • Protein Domains: Ig-like (46-110)
    Ig-like (141-207)
    Ig-like (224-320)
    Ig-like (328-414)
    Ig-like (421-548)
    Ig-like (551-660)
    Ig-like (667-753)
    (834-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR003598  IPR013151  IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  IPR001824  IPR009136  
  • Prosite: PS50835 PS00107 PS50011 PS00109 PS00240
  • PDB: 1VR2 1Y6A 1Y6B 1YWN 2M59 2MET 2MEU 2OH4 2P2H 2P2I 2QU5 2QU6 2RL5 2X1W 2X1X 2XIR 3B8Q 3B8R 3BE2 3C7Q 3CJF 3CJG 3CP9 3CPB 3CPC 3DTW 3EFL 3EWH 3KVQ 3S35 3S36 3S37 3U6J 3V2A 3V6B 3VHE 3VHK 3VID 3VNT 3VO3 3WZD 3WZE 4AG8 4AGC 4AGD 4ASD 4ASE 5EW3
  • PDBsum: 1VR2 1Y6A 1Y6B 1YWN 2M59 2MET 2MEU 2OH4 2P2H 2P2I 2QU5 2QU6 2RL5 2X1W 2X1X 2XIR 3B8Q 3B8R 3BE2 3C7Q 3CJF 3CJG 3CP9 3CPB 3CPC 3DTW 3EFL 3EWH 3KVQ 3S35 3S36 3S37 3U6J 3V2A 3V6B 3VHE 3VHK 3VID 3VNT 3VO3 3WZD 3WZE 4AG8 4AGC 4AGD 4ASD 4ASE 5EW3
  • DIP: 486
  • STRING: ENSP00000263923
• Other Databases: GeneCards:  KDR  Malacards:  KDR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological process
GO:0001570	vasculogenesis	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0003158	endothelium development	ISS	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0004716	signal transducer, downstream of receptor, with protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008360	regulation of cell shape	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016032	viral process	IEA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0023014	signal transduction by protein phosphorylation	IEA	biological process
GO:0030054	cell junction	ISS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0035162	embryonic hemopoiesis	ISS	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	ISS	biological process
GO:0038085	vascular endothelial growth factor binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050927	positive regulation of positive chemotaxis	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IMP	biological process
GO:0051879	Hsp90 protein binding	TAS	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:0097443	sorting endosome	ISS	cellular component
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2001214	positive regulation of vasculogenesis	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0001525	angiogenesis	TAS	biological process
GO:0001570	vasculogenesis	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0003158	endothelium development	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0004716	signal transducer, downstream of receptor, with protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IEA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008360	regulation of cell shape	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IEA	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0023014	signal transduction by protein phosphorylation	IEA	biological process
GO:0030054	cell junction	ISS	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0035162	embryonic hemopoiesis	ISS	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	ISS	biological process
GO:0038085	vascular endothelial growth factor binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050927	positive regulation of positive chemotaxis	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IMP	biological process
GO:0051879	Hsp90 protein binding	TAS	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:0097443	sorting endosome	ISS	cellular component
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2001214	positive regulation of vasculogenesis	ISS	biological process
GO:0001525	angiogenesis	TAS	biological process
GO:0001570	vasculogenesis	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	ISS	biological process
GO:0003158	endothelium development	ISS	biological process
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004713	protein tyrosine kinase activity	EXP	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0004716	signal transducer, downstream of receptor, with protein tyrosine kinase activity	TAS	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005021	vascular endothelial growth factor-activated receptor activity	IDA	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008360	regulation of cell shape	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016239	positive regulation of macroautophagy	IGI	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0019838	growth factor binding	IPI	molecular function
GO:0019838	growth factor binding	IPI	molecular function
GO:0030054	cell junction	ISS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0035162	embryonic hemopoiesis	ISS	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IMP	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0038033	positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	ISS	biological process
GO:0038085	vascular endothelial growth factor binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IDA	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0050927	positive regulation of positive chemotaxis	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IMP	biological process
GO:0051879	Hsp90 protein binding	TAS	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0051901	positive regulation of mitochondrial depolarization	IGI	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0090141	positive regulation of mitochondrial fission	IGI	biological process
GO:0097443	sorting endosome	ISS	cellular component
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:2001214	positive regulation of vasculogenesis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer	GAD: 16807673
Cancer (brain)	GAD: 20446891
Cancer (colorectal)	GAD: 20143086
Cancer (esophageal)	GAD: 20453000
Cancer (Hepatocellular)	GAD: 19160077
Cancer (leukemia)	GAD: 20959405
Cancer (lung)	GAD: 18379357
Cancer (Renal cell)	GAD: 20389299
Cancer (breast)	GAD: 16807673
Hemangioma	OMIM: 191306
Cancer (cervical)	GAD: 19563658
Cancer (solid tumors)	GAD: 19924384
Hypertension	GAD: 20630084
Macular degeneration	GAD: 20019880
Sarcoidosis	GAD: 19741061
Lymphedema	GAD: 18564921
Kawasaki disease	GAD: 15470196
Asthma	GAD: 16630933
Hypercholesterolemia	GAD: 20602615
Bone diseases	GAD: 19453261
Stroke	GAD: 19520980
Alzheimer's disease	GAD: 19141999
Chronic renal failure	GAD: 21085059
Mullerian structure defects	INFBASE: 19200976
Endometriosis	INFBASE: 16179118
Female infertility	INFBASE: 8755660
Septate uterus	INFBASE: 19200976
Pregnancy outcome	INFBASE: 26411207
Premature ovarian failure (POF)	INFBASE: 22510937
Ovarian hyperstimulation syndrome (OHSS)	INFBASE: 24886133
Uterine anomalies	INFBASE: 19200976
Male factor infertility	MIK: 10438994
Endometriosis	INFBASE: 21733043
Deep infiltrating endometriosis	INFBASE: 17765237
Associated with oocyte maturation	INFBASE: 26411207
Associated with fertilization	INFBASE: 26411207
Associated with embryo implantation	INFBASE: 26411207
Neovascularization	GAD: 18975312
Anoxia	GAD: 20215856
Affects both spermatogenesis and somatic-oocyte interactions during gametogenesis	MIK: 20848132
Male infertility	MIK: 10438994
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10438994	Male infertility			80 men whose spermatozoa were subsequently used for IVF or ICSI	Male infertility	Flt-1  KDR VEGF
20848132	Affects both spermatogenesis and somatic-oocyte interactions during gametogenesis				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)