• Gene id: 3783

Gene Summary

• Gene Symbol: KCNN4   Gene   UCSC   Ensembl
• Aliases: DHS2, IK, IK1, IKCA1, KCA4, KCa3.1, SK4, hIKCa1, hKCa4, hSK4
• Gene name: potassium calcium-activated channel subfamily N member 4
• Alternate names: intermediate conductance calcium-activated potassium channel protein 4, SKCa 4, SKCa4, potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 4, potassium intermediate/small conductance calcium-activated channel, subfami,
• Gene location: 19q13.31 (40039201: 40035689)     Exons: 6     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded p
• OMIM: 602754

Protein Summary

• Protein general information: O15554  
  • Name: Intermediate conductance calcium activated potassium channel protein 4 (SK4) (SKCa 4) (SKCa4) (IKCa1) (IK1) (KCa3.1) (KCa4) (Putative Gardos channel)
  • Length: 427  
  • Mass: 47696
  • Tissue specificity: Widely expressed in non-excitable tissues.
• Sequence:

  MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFLVKCTISISTFLLLCL
  IVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPAPVRGPPCVQDLGAPLTSPQPWPGFLGQGEA
  LLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSV
  AERQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
  FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMH
  MILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK

• Structural information:
  • Interpro: IPR004178  IPR036122  IPR015449  IPR013099  
  • PDB: 6CNM 6CNN 6CNO 6D42
  • PDBsum: 6CNM 6CNN 6CNO 6D42
  • DIP: 48598
  • STRING: ENSP00000262888
• Other Databases: GeneCards:  KCNN4  Malacards:  KCNN4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0022894	Intermediate conductance calcium-activated potassium channel activity	IBA	molecular function
GO:0006811	ion transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0005516	calmodulin binding	IBA	molecular function
GO:0015269	calcium-activated potassium channel activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	TAS	molecular function
GO:0006952	defense response	TAS	biological process
GO:0006813	potassium ion transport	TAS	biological process
GO:0008076	voltage-gated potassium channel complex	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005267	potassium channel activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0045332	phospholipid translocation	IEA	biological process
GO:0050714	positive regulation of protein secretion	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0006884	cell volume homeostasis	IEA	biological process
GO:0046541	saliva secretion	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IDA	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0006816	calcium ion transport	IDA	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IDA	biological process
GO:0008076	voltage-gated potassium channel complex	IC	cellular component
GO:0030322	stabilization of membrane potential	IDA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04970	Salivary secretion
hsa04911	Insulin secretion
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Hereditary stomatocytosis	KEGG:H00232
Dehydrated hereditary stomatocytosis	KEGG:H01978
Hereditary stomatocytosis	KEGG:H00232
Dehydrated hereditary stomatocytosis	KEGG:H01978
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq