• Gene id: 3781

Gene Summary

• Gene Symbol: KCNN2   Gene   UCSC   Ensembl
• Aliases: KCa2.2, SK2, SKCA2, SKCa 2, hSK2
• Gene name: potassium calcium-activated channel subfamily N member 2
• Alternate names: small conductance calcium-activated potassium channel protein 2, apamin-sensitive small-conductance Ca2+-activated potassium channel, potassium channel, calcium activated intermediate/small conductance subfamily N alpha, member 2, potassium intermediate/smal,
• Gene location: 5q22.3 (114055977: 114496499)     Exons: 16     NC_000005.10
• Gene summary(Entrez): Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is
• OMIM: 613607

Protein Summary

• Protein general information: Q9H2S1  
  • Name: Small conductance calcium activated potassium channel protein 2 (SK2) (SKCa 2) (SKCa2) (KCa2.2)
  • Length: 579  
  • Mass: 63760
  • Tissue specificity: Expressed in atrial myocytes (at protein level). Widely expressed. {ECO
• Sequence:

  MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSKPEHNN
  SNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMV
  IETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCA
  IHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRF
  VMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVC
  LLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRK
  HQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALP
  GLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS

• Structural information:
  • Interpro: IPR004178  IPR036122  IPR015449  IPR013099  
  • PDB: 5V02 5WBX 5WC5 6ALE
  • PDBsum: 5V02 5WBX 5WC5 6ALE
  • DIP: 48997
  • STRING: ENSP00000427120
• Other Databases: GeneCards:  KCNN2  Malacards:  KCNN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0006811	ion transport	IBA	biological process
GO:0043025	neuronal cell body	IBA	cellular component
GO:0043197	dendritic spine	IBA	cellular component
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0005516	calmodulin binding	IBA	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	IEA	molecular function
GO:0006813	potassium ion transport	IEA	biological process
GO:0015269	calcium-activated potassium channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0015269	calcium-activated potassium channel activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0051393	alpha-actinin binding	IPI	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	IDA	molecular function
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0016286	small conductance calcium-activated potassium channel activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098914	membrane repolarization during atrial cardiac muscle cell action potential	ISS	biological process
GO:0071805	potassium ion transmembrane transport	IDA	biological process
GO:0071805	potassium ion transmembrane transport	ISS	biological process
GO:0030018	Z disc	ISS	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006813	potassium ion transport	NAS	biological process
GO:0016286	small conductance calcium-activated potassium channel activity	IMP	molecular function
GO:0016286	small conductance calcium-activated potassium channel activity	TAS	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04726	Serotonergic synapse
hsa04911	Insulin secretion
hsa04976	Bile secretion
hsa04929	GnRH secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray