• Gene id: 3777

Gene Summary

• Gene Symbol: KCNK3   Gene   UCSC   Ensembl
• Aliases: K2p3.1, OAT1, PPH4, TASK, TASK-1, TASK1, TBAK1
• Gene name: potassium two pore domain channel subfamily K member 3
• Alternate names: potassium channel subfamily K member 3, TWIK-related acid-sensitive K(+) channel 1, TWIK-related acid-sensitive K+ 1, TWIK-related acid-sensitive K+ channel, acid-sensitive potassium channel protein TASK, acid-sensitive potassium channel protein TASK-1, cardiac,
• Gene location: 2p23.3 (26692721: 26733419)     Exons: 3     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the superfamily of potassium channel proteins that contain two pore-forming P domains. The encoded protein is an outwardly rectifying channel that is sensitive to changes in extracellular pH and is inhibited by extracellular
• OMIM: 612031

Protein Summary

• Protein general information: O14649  
  • Name: Potassium channel subfamily K member 3 (Acid sensitive potassium channel protein TASK 1) (TWIK related acid sensitive K(+) channel 1) (Two pore potassium channel KT3.1) (Two pore K(+) channel KT3.1)
  • Length: 394  
  • Mass: 43518
  • Tissue specificity: Widespread expression in adult. Strongest expression in pancreas and placenta. Lower expression in brain, lung, prostate, heart, kidney, uterus, small intestine and colon.
• Sequence:

  MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLKPHKAG
  VQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPLTLVMFQSLGERINTLVRYLLHRAKKGLGMR
  RADVSMANMVLIGFFSCISTLCIGAAAFSHYEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSF
  VYILTGLTVIGAFLNLVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
  AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVS
  TGLHSLSTFRGLMKRRSSV

• Structural information:
  • Interpro: IPR003280  IPR003092  IPR013099  IPR005406  
  • PDB: 6RV2 6RV3 6RV4
  • PDBsum: 6RV2 6RV3 6RV4
  • STRING: ENSP00000306275
• Other Databases: GeneCards:  KCNK3  Malacards:  KCNK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0022841	potassium ion leak channel activity	IDA	molecular function
GO:0005252	open rectifier potassium channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0005267	potassium channel activity	TAS	molecular function
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006813	potassium ion transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0061337	cardiac conduction	TAS	biological process
GO:0005252	open rectifier potassium channel activity	IEA	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0071456	cellular response to hypoxia	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0051481	negative regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0071294	cellular response to zinc ion	IEA	biological process
GO:0090102	cochlea development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0034220	ion transmembrane transport	IMP	biological process
GO:0005886	plasma membrane	IMP	cellular component
GO:0044548	S100 protein binding	IPI	molecular function
GO:0005216	ion channel activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04934	Cushing syndrome
hsa04925	Aldosterone synthesis and secretion
hsa04927	Cortisol synthesis and secretion

Diseases

Associated diseases	References
Pulmonary arterial hypertension	KEGG:H01621
Pulmonary arterial hypertension	KEGG:H01621
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq